KEGG   Pan troglodytes (chimpanzee): 743199Help
Entry
743199            CDS       T01005                                 

Gene name
MAP2K7
Definition
mitogen-activated protein kinase kinase 7
Orthology
K04431  
mitogen-activated protein kinase kinase 7 [EC:2.7.12.2]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
MAPK signaling pathway
ErbB signaling pathway
Protein processing in endoplasmic reticulum
Osteoclast differentiation
Toll-like receptor signaling pathway
T cell receptor signaling pathway
Fc epsilon RI signaling pathway
TNF signaling pathway
Neurotrophin signaling pathway
GnRH signaling pathway
Influenza A
Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    743199 (MAP2K7)
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    743199 (MAP2K7)
   04012 ErbB signaling pathway
    743199 (MAP2K7)
   04668 TNF signaling pathway
    743199 (MAP2K7)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    743199 (MAP2K7)
   04660 T cell receptor signaling pathway
    743199 (MAP2K7)
   04664 Fc epsilon RI signaling pathway
    743199 (MAP2K7)
  Endocrine system
   04912 GnRH signaling pathway
    743199 (MAP2K7)
  Nervous system
   04722 Neurotrophin signaling pathway
    743199 (MAP2K7)
  Development
   04380 Osteoclast differentiation
    743199 (MAP2K7)
 Human Diseases
  Infectious diseases
   05164 Influenza A
    743199 (MAP2K7)
   05169 Epstein-Barr virus infection
    743199 (MAP2K7)
Enzymes [BR:ptr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     743199 (MAP2K7)
Protein kinases [BR:ptr01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   743199 (MAP2K7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
19
AA seq 426 aa AA seqDB search
MAASSLEQKLSRLEAKLKQENREARRRIDLNLDISPQRPRPTLQLPLANDGGSRSPSSES
SPQHPTPPARPRHMLGLPSTLFTPRSMESIEIDQKLQEIMKQTGYLTIGGQRYQAEINDL
ENLGEMGSGTCGQVWKMRFRKTGHVIAVKQMRRSGNKEENKRILMDLDVVLKSHDCPYIV
QCFGTFITNTDVFIAMELMGTCAEKLKKRMQGPIPERILGKMTVAIVKALYYLKEKHGVI
HRDVKPSNILLDERGQIKLCDFGISGRLVDSKAKTRSAGCAAYMAPERIDPPDPTKPDYD
IRADVWSLGISLPCPSPSQVELATGQFPYKNCKTDFEVLTKVLQEEPPLLPGHMGFSGDF
QSFVKDCLTKDHRKRPKYNKLLEHSFIKRYETLEVDVASWFKDVMAKTESPRTSGVLSQP
HLPFFR
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgtcctccctggagcagaagctgtcccgcctggaagcaaagctgaagcaggag
aaccgggaggcccggcggaggatcgacctcaacctggatatcagcccccagcggcccagg
cccaccctgcagctcccgctggccaacgatgggggcagccgctcgccatcctcagagagc
tccccgcagcaccccacgccccctgcccggccccgccacatgctggggctcccgtcaacc
ctgttcacaccccgcagcatggagagcattgagattgaccagaagctgcaggagatcatg
aagcagacgggctacctgaccatcgggggccagcgctaccaggcagaaatcaacgacctg
gagaacttgggcgagatgggcagcggcacctgcggccaggtttggaagatgcgcttccgg
aagaccggccacgtcattgccgttaagcaaatgcggcgctcggggaacaaggaggagaac
aagcgcatcctcatggacctggatgtggtgctcaagagccacgactgcccctacatcgtg
cagtgctttgggacgttcatcaccaacacggacgtcttcatcgccatggagctcatgggc
acctgcgctgaaaagctcaagaagcggatgcagggccccattcccgagcgcattctgggc
aagatgacagtggcgattgtgaaggcgctgtactacctgaaggagaagcacggtgtcatc
caccgcgacgtcaagccctccaacatcctgctggacgagcggggccagatcaagctctgc
gacttcggcatcagcggccgcctggtggactccaaagccaagacgcggagcgccggctgt
gccgcctacatggcacccgagcgcattgaccccccagaccccaccaagccggactatgac
atccgggccgacgtatggagcctgggcatctcgttgccctgcccgtctccctcccaggtg
gagctggcaacaggacagtttccctacaagaactgcaagacggactttgaggtcctcacc
aaagtcctacaggaagagcccccgcttctgcccggacacatgggcttctcgggggacttc
cagtccttcgtcaaagactgccttactaaagatcacaggaagagaccaaagtataataag
ctacttgaacacagcttcatcaagcgctacgagacgctggaggtggacgtggcgtcctgg
ttcaaggatgtcatggcgaagactgagtcaccgcggactagcggcgtcctgagccagccc
cacctgcccttcttcaggtag

  All links  
No link information was found.   
DBGET integrated database retrieval system