KEGG   Pan troglodytes (chimpanzee): 743607Help
Entry
743607            CDS       T01005                                 

Gene name
UGT2B17
Definition
(RefSeq) UDP-glucuronosyltransferase 2B17
  KO
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Steroid hormone biosynthesis
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Chemical carcinogenesis
Module
Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    743607 (UGT2B17)
   00053 Ascorbate and aldarate metabolism
    743607 (UGT2B17)
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    743607 (UGT2B17)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    743607 (UGT2B17)
   00860 Porphyrin and chlorophyll metabolism
    743607 (UGT2B17)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    743607 (UGT2B17)
   00982 Drug metabolism - cytochrome P450
    743607 (UGT2B17)
   00983 Drug metabolism - other enzymes
    743607 (UGT2B17)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    743607 (UGT2B17)
Enzymes [BR:ptr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     743607 (UGT2B17)
Glycosyltransferases [BR:ptr01003]
 Others
  Hydrophobic molecule
   743607 (UGT2B17)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
4
AA seq 337 aa AA seqDB search
MSLKWMSVFLLMQLNCYFSSGSCGKVLVWPTEYSHWINMKTILEELVQRGHEVIVLTSSA
SILVNASKSSAIKLEVYPTSLTKNDWEDFFMKMFDRWIYSISKNTFWSYFSQLQELCWEY
SDYNIKLCEDAVLNKKLMRKLQESKFDVLLADAVNPCGELLAELLNIPFLYSLRFSVGYT
VEKNGGGFLFPPSYVPVVMSELSDQMNFMERIKNMIYMLYFDFWFQAYDLKRWDQFYSEV
LGRPTTLFETMGKAEMWLIRTYWDFEFPRPFLPNVDFVGGLHCKSAKPLPKEMEEFVQSS
GENGIVVFSLGSMISNTSEESANMIASALAQIPQKVR
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgtctctgaaatggatgtcagtctttctactgatgcagctcaattgttactttagctct
gggagttgtggaaaggtgctggtgtggcccacagaatacagccattggataaatatgaag
acaatcctggaagagcttgttcagaggggtcatgaggtgattgtgttgacatcttcggct
tctattcttgtcaatgccagtaaatcatctgctattaaattagaagtttatcctacatct
ttaactaaaaatgattgggaagatttttttatgaaaatgttcgatagatggatatatagt
atttcaaaaaatacattttggtcatatttctcacaactacaagaattgtgttgggaatat
tctgactataatataaagctctgtgaggatgcagttttgaacaagaaacttatgagaaaa
ctacaagagtcaaaatttgatgtccttctggcagatgccgttaatccctgtggtgagctg
ctggctgagctacttaacataccctttctgtacagtcttcgattctctgttggctataca
gttgagaagaatggtggaggatttctgttccctccttcctatgtacctgttgttatgtca
gaattaagtgatcaaatgaatttcatggagaggataaaaaatatgatatatatgctttat
tttgacttttggtttcaagcatatgatctgaagaggtgggaccagttttatagtgaagtt
ctaggaagacccactacattatttgagacaatggggaaagctgaaatgtggctcattcga
acctattgggattttgaatttcctcgcccattcttaccaaatgttgattttgttggagga
cttcactgtaaatcagccaaacccttgcctaaggaaatggaagagtttgtgcagagctct
ggagaaaatggtattgtggtgttttctctggggtcgatgatcagtaacacgtcagaagaa
agtgccaacatgattgcatcagccctcgcccagatcccacaaaaggttagataa

DBGET integrated database retrieval system