KEGG   Pan troglodytes (chimpanzee): 743656Help
Entry
743656            CDS       T01005                                 

Gene name
PPP1CC
Definition
protein phosphatase 1, catalytic subunit, gamma isoform
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
mRNA surveillance pathway
cGMP-PKG signaling pathway
cAMP signaling pathway
Oocyte meiosis
Adrenergic signaling in cardiomyocytes
Vascular smooth muscle contraction
Hippo signaling pathway
Focal adhesion
Platelet activation
Long-term potentiation
Dopaminergic synapse
Inflammatory mediator regulation of TRP channels
Regulation of actin cytoskeleton
Insulin signaling pathway
Oxytocin signaling pathway
Amphetamine addiction
Alcoholism
Herpes simplex infection
Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Genetic Information Processing
  Translation
   03015 mRNA surveillance pathway
    743656 (PPP1CC)
 Environmental Information Processing
  Signal transduction
   04390 Hippo signaling pathway
    743656 (PPP1CC)
   04024 cAMP signaling pathway
    743656 (PPP1CC)
   04022 cGMP - PKG signaling pathway
    743656 (PPP1CC)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    743656 (PPP1CC)
  Cell growth and death
   04114 Oocyte meiosis
    743656 (PPP1CC)
  Cellular commiunity
   04510 Focal adhesion
    743656 (PPP1CC)
 Organismal Systems
  Immune system
   04611 Platelet activation
    743656 (PPP1CC)
  Endocrine system
   04910 Insulin signaling pathway
    743656 (PPP1CC)
   04921 Oxytocin signaling pathway
    743656 (PPP1CC)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    743656 (PPP1CC)
   04270 Vascular smooth muscle contraction
    743656 (PPP1CC)
  Nervous system
   04728 Dopaminergic synapse
    743656 (PPP1CC)
   04720 Long-term potentiation
    743656 (PPP1CC)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    743656 (PPP1CC)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    743656 (PPP1CC)
  Substance dependence
   05031 Amphetamine addiction
    743656 (PPP1CC)
   05034 Alcoholism
    743656 (PPP1CC)
  Infectious diseases
   05168 Herpes simplex infection
    743656 (PPP1CC)
Enzymes [BR:ptr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     743656 (PPP1CC)
Protein phosphatases and associated proteins [BR:ptr01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     743656 (PPP1CC)
Transcription machinery [BR:ptr03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     743656 (PPP1CC)
Spliceosome [BR:ptr03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    743656 (PPP1CC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6
AA seq 337 aa AA seqDB search
MADLDKLNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLK
ICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFL
LRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDL
QSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHD
LDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAE
KKKPNATRPVTPPRVASGLNPSIQKASNYRNNTVLYE
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atggcggatttagataaactcaacatcgacagcattatccaacggctgctggaagtgaga
gggtccaagcctggtaagaatgtccagcttcaggagaatgaaatcagaggactgtgctta
aagtctcgtgaaatctttctcagtcagcctatcctactagaacttgaagcaccactcaaa
atatgtggtgacatccatggacaatactatgatttgctgcgactttttgagtacgggggt
ttcccaccagaaagcaactacctgtttcttggggactatgtggacaggggaaagcagtca
ttggagacgatctgcctcttactggcctacaaaatcaaatatcctgagaatttttttctt
ctcagagggaaccatgaatgtgccagcatcaacagaatttatggattttatgatgaatgt
aaaagaagatacaacattaaactatggaaaactttcacagactgttttaactgtttaccg
atagcagccatcgtggatgagaagatattctgctgtcatggaggtttatcaccagatctt
caatctatggagcagattcggcgaattatgcgaccaactgatgtaccagatcaaggtctt
ctttgtgatcttttgtggtctgaccccgataaagatgtcttaggctggggtgaaaatgac
agaggagtgtccttcacatttggtgcagaagtggttgcaaaatttctccataagcatgat
ttggatcttatatgtagagcccatcaggtggttgaagatggatatgaattttttgcaaag
aggcagttggtcactctgttttctgcgcccaattattgtggagagtttgacaatgcaggt
gccatgatgagtgtggatgaaacactaatgtgttcttttcagattttaaagcctgcagag
aaaaagaagccaaatgccacgagacctgtaacgcctccaagggttgcatcaggcctgaac
ccgtccattcagaaagcttcaaattatagaaacaatactgttctatacgagtga

DBGET integrated database retrieval system