KEGG   Pan troglodytes (chimpanzee): 744064Help
Entry
744064            CDS       T01005                                 

Gene name
ADH1A
Definition
(RefSeq) alcohol dehydrogenase 1A isoform X1
  KO
K13951  alcohol dehydrogenase 1/7 [EC:1.1.1.1]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr00010  Glycolysis / Gluconeogenesis
ptr00071  Fatty acid degradation
ptr00350  Tyrosine metabolism
ptr00830  Retinol metabolism
ptr00980  Metabolism of xenobiotics by cytochrome P450
ptr00982  Drug metabolism - cytochrome P450
ptr01100  Metabolic pathways
ptr05204  Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    744064 (ADH1A)
  Lipid metabolism
   00071 Fatty acid degradation
    744064 (ADH1A)
  Amino acid metabolism
   00350 Tyrosine metabolism
    744064 (ADH1A)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    744064 (ADH1A)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    744064 (ADH1A)
   00982 Drug metabolism - cytochrome P450
    744064 (ADH1A)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    744064 (ADH1A)
Enzymes [BR:ptr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     744064 (ADH1A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_zinc_N ADH_N ADH_zinc_N_2 UDPG_MGDP_dh_N AlaDh_PNT_C 2-Hacid_dh_C
Motif
Other DBs
NCBI-GeneID: 744064
NCBI-ProteinID: XP_001166683
Ensembl: ENSPTRG00000041356
UniProt: H2QPX7
Position
4
AA seq 375 aa AA seqDB search
MSTAGKVIKCKAAVLWELKKPFSIEEVEVAPPKAHEVRIKMVAVGICGTDDHVVSGTMVT
PLPVILGHEAAGIVESVGEGVTTVKPGDKVIPLALPQCGKCRICKNPESNYCLKNNVNNP
QGTLQDGTSRFTCRGKPIHHFLGISTFSQYTVVDENAVAKIDAASPLEKVCLIGCGFSTG
YGSAVNVAKVTPGSTCAVFGLGGVGLSAIMGCKAAGAARIIAVDINKDKFAKAKELGATE
CINPQDYKKPIQEVLKEMTDGGVDFSFEVIGRLDTMMASLLCCHEACGTSVIVGVPPDSQ
NLSMNPMLLLTGRTWKGAILGGFKSKECVPKLVADFMAKKFSLDVLITHVLPFEKINEGF
DLLHSGKSIRTILMF
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgagcacagcaggaaaagtaatcaaatgcaaagcagctgtgctatgggagttaaagaaa
cccttttccattgaggaggtggaggttgcacctcctaaggcccatgaagttcgtattaag
atggtggctgtaggaatctgtggcacagatgaccacgtggttagtggtaccatggtgacc
ccacttcctgtgattttaggccatgaggcagccggcatcgtggagagtgttggagaaggg
gtgactacagtcaaaccaggtgataaagtcatcccactcgctcttcctcagtgtggaaaa
tgcagaatttgtaaaaacccggagagcaactactgcttgaaaaacaatgtgaacaatcct
caggggaccctgcaggatggcaccagcaggttcacctgcagggggaagcccatccaccac
ttccttggcatcagcaccttctcacagtacacagtggtggatgaaaatgcagtagccaaa
attgatgcagcctcgcccctagagaaagtctgtctcattggctgtggattttcaactggt
tatgggtctgcagtcaatgttgccaaggtcaccccaggctctacctgtgctgtgtttggc
ctgggaggggtcggcctatctgctattatgggctgtaaagcagctggggcagccagaatc
attgcggtggacatcaacaaggacaaatttgcaaaggccaaagagttgggtgccactgaa
tgcatcaaccctcaagactacaagaaacccatccaggaggtgctaaaggaaatgactgat
ggaggtgtggatttttcgtttgaagtcatcggtcggcttgacaccatgatggcttccctg
ttatgttgtcatgaggcatgtggcacaagtgtcatcgtaggggtacctcctgattcccaa
aacctctcaatgaaccctatgctgctactgactggacgtacctggaagggagctattctt
ggtggctttaagagtaaagaatgtgtcccaaaacttgtggctgattttatggctaagaag
ttttcattggatgtattaataacccatgttttaccttttgaaaaaataaatgaaggattt
gacctgcttcactctgggaaaagtatccgtaccattctgatgttttga

DBGET integrated database retrieval system