KEGG   Pan troglodytes (chimpanzee): 744176Help
Entry
744176            CDS       T01005                                 

Gene name
ADH1C
Definition
alcohol dehydrogenase 1C
Orthology
K13951  
alcohol dehydrogenase 1/7 [EC:1.1.1.1]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Retinol metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Metabolic pathways
Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    744176 (ADH1C)
  Lipid metabolism
   00071 Fatty acid degradation
    744176 (ADH1C)
  Amino acid metabolism
   00350 Tyrosine metabolism
    744176 (ADH1C)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    744176 (ADH1C)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    744176 (ADH1C)
   00982 Drug metabolism - cytochrome P450
    744176 (ADH1C)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    744176 (ADH1C)
Enzymes [BR:ptr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     744176 (ADH1C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4
AA seq 421 aa AA seqDB search
MCVVGIGCYMSKQNKYLCNIPALCTQAEKKSQVLTSLLVCREDRINMSTAGKVIKCKAAV
LWELKKPFSIEEVEVAPPKAHEVRIKMVAAGICRSDEHVVSGDLVTPLPVILGHEAAGIV
ESVGEGVTTVKPGDKVIPLFTPQCGKCRICKNPESNYCLKNDLGNPRGTLQDGTRRFTCS
GKPIHHFVGVSTFSQYTVVDENAVAKIDAASPLEKVCLIGCGFSTGYGSAVKVAKVTPGS
TCAVFGLGGVGLSVVMGCKAAGAARIIAVDINKDKFAKAKELGATECINPQDYKKPIQEV
LKEMTDGGVDFSFEVIGRLDTMMASLLCCHEACGTSVIVGVPPDSQNLSINPMLLLTGRT
WKGAIFGGFKSKESVPKLVADFMAKKFSLDALITNVLPFEKINEGFDLLRSGKSIRTVLT
F
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgtgtgtagttggaattgggtgttatatgagcaaacaaaataaatacctgtgcaacata
cctgctttatgcactcaagcagagaagaaatcacaagtactcaccagcctcctggtctgc
agagaagacagaatcaatatgagcacagcaggaaaagtaatcaaatgcaaagcagctgtg
ctatgggagttaaagaaacccttttccattgaggaggtagaggttgcacctcctaaggct
catgaagttcgcattaagatggtggctgcaggaatctgtcgttcagatgagcatgtggtt
agtggcgacctggtgaccccccttcctgtgattttaggccatgaggcagccggcatcgtg
gaaagtgttggagaaggggtgactacagtcaaaccaggtgataaagtcatcccgctcttt
actcctcagtgtggaaaatgcagaatttgtaaaaacccagaaagcaactactgcttgaaa
aatgatctaggcaatcctcgggggaccctgcaggatggcaccaggaggttcacctgcagc
gggaagcccatccaccacttcgtcggcgtcagcaccttctcccagtacacggtggtggat
gagaatgcagtagccaaaattgatgcagcctcgcccctggagaaagtttgcctcattggc
tgtggattttcgactggttatgggtctgcagtcaaagttgccaaggtcaccccagggtct
acctgtgctgtgtttggcctgggaggggtcggcctatctgttgttatgggctgtaaagca
gctggagcagccagaatcattgctgtggacatcaacaaggacaaatttgcaaaggctaaa
gagttgggtgccactgaatgcatcaaccctcaagactacaagaaacccatccaggaggtg
ctaaaggaaatgactgatggaggtgtggatttttcgtttgaagtcatcggtcggcttgac
accatgatggcttccctgttatgttgtcatgaggcatgtggcacaagtgtcattgtaggg
gtacctcctgattcccagaacctctcaataaaccctatgctgctactgactggacgcacg
tggaaaggagctatttttggaggctttaagagtaaagaatctgtccccaaacttgtggct
gactttatggctaagaagttttcactggatgcattaataacaaatgttttaccttttgaa
aaaataaatgaaggatttgacctgcttcgctctggaaagagtatccgtaccgtcctgacg
ttttga

DBGET integrated database retrieval system