KEGG   Pan troglodytes (chimpanzee): 744329Help
Entry
744329            CDS       T01005                                 

Gene name
GTF3C4
Definition
(RefSeq) general transcription factor IIIC subunit 4
  KO
K11310  
general transcription factor 3C polypeptide 4 [EC:2.3.1.48]
Organism
ptr  Pan troglodytes (chimpanzee)
Brite
Enzymes [BR:ptr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     744329 (GTF3C4)
Transcription machinery [BR:ptr03021]
 Eukaryotic type
  RNA polymerase III system
   Basal transcription factors
    TFIIIC
     744329 (GTF3C4)
Chromosome [BR:ptr03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    744329 (GTF3C4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
9
AA seq 822 aa AA seqDB search
MNTADQARVGPADDGPAPSGEEEGEGGGEAGGKEPAADAAPGPSAAFRLMVTRREPAVKL
QYAVSGLEPLAWSEDHRVSVSTARSIAVLELICDVHNPGQDLVIHRTSVPAPLNSCLLKV
GSKTEVAECKEKFAASKDPTVSQTFMLDRVFNPEGKALPPMRGFKYTSWSPMGCDANGRC
LLAALTMDNRLTIQANLNRLQWVQLVDLTEIYGERLYETSYRLSKNEAPEGNLGDFAEFQ
RRHSMQTPVRMEWSGICTTQQVKHNNECRDVGSVLLAVLFENGNIAVWQFQLPFVGKESI
SSCNTIESGITSPSVLFWWEYEHNNRKMSGLIVGSAFGPIKILPVNLKAVKGYFTLRQPV
ILWKEMDQLPVHSIKCVPLYHPYQKCSCSLVVAARGSYVFWCLLLISKAGLNVHNSHVTG
LHSLPIVSMTADKQNGTVYTCSSDGKVRQLIPIFTDVALKFEHQLIKLSDVFGSVRTHGI
AVSPCGAYLAIITTEGMINGLHPVNKNYQVQFVTLKTFEEAAAQLLESSVQNLFKQVDLI
DLVRWKILKDKHIPQFLQEALEKKIESSGVTYFWRFKLFLLRILYQSMQKTPSEALWKPT
HEDSKILLVDSPGMGNADDEQQEEGTSSKQVVKQGLQERSKEGDVEEPTDDSLPTTGDAG
GREPMEEKLLEIQGKIEAVEMHLTREHMKRVLGEVYLHTWITENTSIPTRGLCNFLMSDE
EYDDRTARVLIGHISKKMNKQTFPEHCSLCKEILPFTDRKQAVCSNGHIWLRCFLTYQSC
QSLIYRRCLLHDSIARHPAPEDPDWIKRLLQSPCPFCDSPVF
NT seq 2469 nt NT seq  +upstreamnt  +downstreamnt
atgaacacggccgaccaggcccgggtggggcccgcggacgacgggcctgcgccgtccggg
gaggaggagggagaggggggcggcgaggcgggcgggaaggagccagcagcggacgcggcc
ccggggcccagcgctgcattccgcctcatggtgactcggcgggagccggccgtgaagctg
cagtatgcggtgagcggcctggaaccgctggcttggtccgaggaccaccgcgtgtctgtg
tccacggcccgcagcatcgctgtgctggagctcatctgcgacgtgcacaacccgggccag
gacctggttatccaccgcacctcggtgcccgcaccgctcaacagctgtctcctcaaagtt
ggctcaaaaacagaagttgctgagtgcaaggagaaattcgccgcctccaaggaccccacg
gtcagtcagactttcatgttggatagggtgttcaaccctgaggggaaggctttaccacca
atgagaggattcaagtacaccagctggtctcccatgggttgcgatgctaatggcaggtgc
ctcttggcagcactgaccatggacaatcgcctgaccatccaggcaaatctcaacagactg
cagtgggtccagctggttgacctgactgagatctatggagaacgtctttatgagaccagt
tacaggctctctaaaaatgaggccccggaaggaaatcttggggattttgctgagtttcag
aggagacacagcatgcagaccccagtcagaatggagtggtcgggcatctgtaccacccag
caggtcaagcataacaacgaatgccgggacgttggcagtgtgctcctggctgtcctcttt
gaaaacggtaatatcgccgtgtggcagtttcagctgccgtttgtaggaaaagaatccatc
tcttcatgcaacacaattgagtcaggaatcacctctcccagtgtattgttttggtgggaa
tatgagcacaataatcgaaaaatgagtggccttattgtggggagtgcttttggacccata
aaaattcttcctgtcaatctcaaagcagtcaaaggctatttcactttaaggcagcctgtt
atcttgtggaaagaaatggaccagttacctgtgcacagtatcaaatgtgtgccactttat
catccttaccagaagtgtagttgcagcttagtagtggctgcaagaggctcttatgtattt
tggtgtcttcttctgatctccaaagcagggctgaatgttcacaattcccatgtcacaggc
cttcactcactgccgattgtctccatgactgcagacaaacagaatggaacagtctatact
tgctccagtgacggaaaggtgaggcagctgattcccattttcacagatgttgcattgaag
tttgaacaccagttgattaaactctcagatgtgtttggctcagtgaggactcatgggata
gcagtgagcccctgcggtgcgtacctggccatcatcaccactgagggcatgatcaacggc
ctccaccctgttaacaaaaactaccaggtccagtttgttactctcaaaaccttcgaagag
gcagctgctcagctcctggaatcttcagttcaaaacctttttaagcaggtagatttaata
gacctagtacgctggaagattttaaaagataaacatatccctcaatttttacaagaagct
ttggaaaaaaagattgaaagcagtggagtcacctatttttggcgttttaagcttttcctc
ctgaggattttatatcagtcaatgcagaaaaccccttcagaagccttgtggaaacccacc
catgaggactcaaaaatcttactagtggattcgcctgggatgggcaatgctgacgatgaa
cagcaggaagaaggcacttcttccaaacaggtggtgaagcaaggcctgcaggagaggagc
aaggaaggagatgtagaggagcccactgatgactcgctccccacgactggagatgctgga
ggccgtgagccaatggaagagaaactcctggaaatccaagggaaaatcgaagctgtggag
atgcacttgaccagggaacacatgaagcgagtcttaggagaagtgtatctgcacacctgg
atcacagaaaacactagcatccccacccgcggactctgtaactttttaatgtctgatgaa
gagtatgatgacagaactgcacgggtgctgattggacatatctcaaagaagatgaacaaa
cagactttccctgagcactgtagtttgtgtaaagagatcttgccattcacagatcgcaaa
caggcagtctgttccaatggccacatttggctccggtgcttcttaacctaccagtcctgc
cagagtttgatatatagaaggtgtttgctccatgacagcattgcccggcatccagctcca
gaagatcccgactggattaagaggttactgcaaagcccctgccctttctgtgattctcct
gtcttctaa

DBGET integrated database retrieval system