KEGG   Pan troglodytes (chimpanzee): 744329Help
Entry
744329            CDS       T01005                                 

Gene name
GTF3C4
Definition
general transcription factor IIIC, polypeptide 4, 90kDa
Orthology
K11310  
general transcription factor 3C polypeptide 4 [EC:2.3.1.48]
Organism
ptr  Pan troglodytes (chimpanzee)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
9
AA seq 773 aa AA seqDB search
MNTADQARVGPADDGPAPSGEEEGEGGGEAGGKEPAADAAPGPSAAFRLMVTRREPAEKR
STRALCGLKLVGSKTEVAECKEKFAASKDPTVSQTFMLDRVFNPEGKALPPMRGFKYTSW
SPMGCDANGRCLLAALTMDNRLTIQANLNRLQWVQLVDLTEIYGERLYETSYRLSKNEAP
EGNLGDFAEFQRRHSMQTPVRMEWSGICTTQQVKHNNECRDVGSVLLAVLFENGNIAVWQ
FQLPFVGKESISSCNTIESGITSPSVLFWWEYEHNNRKMSGLIVGSAFGPIKILPVNLKA
VKGYFTLRQPVILWKEMDQLPVHSIKCVPLYHPYQKCSCSLVVAARGSYVFWCLLLISKA
GLNVHNSHVTGLHSLPIVSMTADKQNGTVYTCSSDGKVRQLIPIFTDVALKFEHQLIKLS
DVFGSVRTHGIAVSPCGAYLAIITTEGMINGLHPVNKNYQVQFVTLKTFEEAAAQLLESS
VQNLFKQVDLIDLVRWKILKDKHIPQFLQEALEKKIESSGVTYFWRFKLFLLRILYQSMQ
KTPSEALWKPTHEDSKILLVDSPGMGNADDEQQEEGTSSKQVVKQGLQERSKEGDVEEPT
DDSLPTTGDAGGREPMEEKLLEIQGKIEAVEMHLTREHMKRVLGEVYLHTWITENTSIPT
RGLCNFLMSDEEYDDRTARVLIGHISKKMNKQTFPEHCSLCKEILPFTDRKQAVCSNGHI
WLRCFLTYQSCQSLIYRRCLLHDSIARHPAPEDPDWIKRLLQSPCPFCDSPVF
NT seq 2322 nt NT seq  +upstreamnt  +downstreamnt
atgaacacggccgaccaggcccgggtggggcccgcggacgacgggcctgcgccgtccggg
gaggaggagggagaggggggcggcgaggcgggcgggaaggagccagcagcggacgcggcc
ccggggcccagcgctgcattccgcctcatggtgactcggcgggagccggccgagaagcgt
tctacaagagccctctgtgggttaaaactggttggctcaaaaacagaagttgctgagtgc
aaggagaaattcgccgcctccaaggaccccacggtcagtcagactttcatgttggatagg
gtgttcaaccctgaggggaaggctttaccaccaatgagaggattcaagtacaccagctgg
tctcccatgggttgcgatgctaatggcaggtgcctcttggcagcactgaccatggacaat
cgcctgaccatccaggcaaatctcaacagactgcagtgggtccagctggttgacctgact
gagatctatggagaacgtctttatgagaccagttacaggctctctaaaaatgaggccccg
gaaggaaatcttggggattttgctgagtttcagaggagacacagcatgcagaccccagtc
agaatggagtggtcgggcatctgtaccacccagcaggtcaagcataacaacgaatgccgg
gacgttggcagtgtgctcctggctgtcctctttgaaaacggtaatatcgccgtgtggcag
tttcagctgccgtttgtaggaaaagaatccatctcttcatgcaacacaattgagtcagga
atcacctctcccagtgtattgttttggtgggaatatgagcacaataatcgaaaaatgagt
ggccttattgtggggagtgcttttggacccataaaaattcttcctgtcaatctcaaagca
gtcaaaggctatttcactttaaggcagcctgttatcttgtggaaagaaatggaccagtta
cctgtgcacagtatcaaatgtgtgccactttatcatccttaccagaagtgtagttgcagc
ttagtagtggctgcaagaggctcttatgtattttggtgtcttcttctgatctccaaagca
gggctgaatgttcacaattcccatgtcacaggccttcactcactgccgattgtctccatg
actgcagacaaacagaatggaacagtctatacttgctccagtgacggaaaggtgaggcag
ctgattcccattttcacagatgttgcattgaagtttgaacaccagttgattaaactctca
gatgtgtttggctcagtgaggactcatgggatagcagtgagcccctgcggtgcgtacctg
gccatcatcaccactgagggcatgatcaacggcctccaccctgttaacaaaaactaccag
gtccagtttgttactctcaaaaccttcgaagaggcagctgctcagctcctggaatcttca
gttcaaaacctttttaagcaggtagatttaatagacctagtacgctggaagattttaaaa
gataaacatatccctcaatttttacaagaagctttggaaaaaaagattgaaagcagtgga
gtcacctatttttggcgttttaagcttttcctcctgaggattttatatcagtcaatgcag
aaaaccccttcagaagccttgtggaaacccacccatgaggactcaaaaatcttactagtg
gattcgcctgggatgggcaatgctgacgatgaacagcaggaagaaggcacttcttccaaa
caggtggtgaagcaaggcctgcaggagaggagcaaggaaggagatgtagaggagcccact
gatgactcgctccccacgactggagatgctggaggccgtgagccaatggaagagaaactc
ctggaaatccaagggaaaatcgaagctgtggagatgcacttgaccagggaacacatgaag
cgagtcttaggagaagtgtatctgcacacctggatcacagaaaacactagcatccccacc
cgcggactctgtaactttttaatgtctgatgaagagtatgatgacagaactgcacgggtg
ctgattggacatatctcaaagaagatgaacaaacagactttccctgagcactgtagtttg
tgtaaagagatcttgccattcacagatcgcaaacaggcagtctgttccaatggccacatt
tggctccggtgcttcttaacctaccagtcctgccagagtttgatatatagaaggtgtttg
ctccatgacagcattgcccggcatccagctccagaagatcccgactggattaagaggtta
ctgcaaagcccctgccctttctgtgattctcctgtcttctaa

DBGET integrated database retrieval system