KEGG   Pan troglodytes (chimpanzee): 744467Help
Entry
744467            CDS       T01005                                 

Gene name
PRKG1
Definition
(RefSeq) cGMP-dependent protein kinase 1 isoform X2
  KO
K07376  cGMP-dependent protein kinase 1 [EC:2.7.11.12]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr04022  cGMP-PKG signaling pathway
ptr04270  Vascular smooth muscle contraction
ptr04540  Gap junction
ptr04611  Platelet activation
ptr04713  Circadian entrainment
ptr04714  Thermogenesis
ptr04730  Long-term depression
ptr04740  Olfactory transduction
ptr04923  Regulation of lipolysis in adipocytes
ptr04970  Salivary secretion
Module
ptr_M00694  cGMP signaling
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Environmental Information Processing
  Signal transduction
   04022 cGMP - PKG signaling pathway
    744467 (PRKG1)
 Cellular Processes
  Cellular community - eukaryotes
   04540 Gap junction
    744467 (PRKG1)
 Organismal Systems
  Immune system
   04611 Platelet activation
    744467 (PRKG1)
  Endocrine system
   04923 Regulation of lipolysis in adipocyte
    744467 (PRKG1)
  Circulatory system
   04270 Vascular smooth muscle contraction
    744467 (PRKG1)
  Digestive system
   04970 Salivary secretion
    744467 (PRKG1)
  Nervous system
   04730 Long-term depression
    744467 (PRKG1)
  Sensory system
   04740 Olfactory transduction
    744467 (PRKG1)
  Environmental adaptation
   04713 Circadian entrainment
    744467 (PRKG1)
   04714 Thermogenesis
    744467 (PRKG1)
Enzymes [BR:ptr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.12  cGMP-dependent protein kinase
     744467 (PRKG1)
Protein kinases [BR:ptr01001]
 Serine/threonine kinases: AGC group
  PKG family
   744467 (PRKG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase cNMP_binding Pkinase_Tyr PKcGMP_CC Kinase-like Wtap APH Pkinase_C Atg14 Tnp_22_trimer Med4 OmpH IncA
Motif
Other DBs
NCBI-GeneID: 744467
NCBI-ProteinID: XP_001162783
Ensembl: ENSPTRG00000002509
UniProt: K6ZDM7
Position
10
AA seq 671 aa AA seqDB search
MSELEEDFAKILMLKEERIKELEKRLSEKEEEIQELKRKLHKCQSVLPVPSTHIGPRTTR
AQGISAEPQTYRSFHDLRQAFRKFTKSERSKDLIKEAILDNDFMKNLELSQIQEIVDCMY
PVEYGKDSCIIKEGDVGSLVYVMEDGKVEVTKEGVKLCTMGPGKVFGELAILYNCTRTAT
VKTLVNVKLWAIDRQCFQTIMMRTGLIKHTEYMEFLKSVPTFQSLPEEILSKLADVLEET
HYENGEYIIRQGARGDTFFIISKGTVNVTREDSPSEDPVFLRTLGKGDWFGEKALQGEDV
RTANVIAAEAVTCLVIDRDSFKHLIGGLDDVSNKAYEDAEAKAKYEAEAAFFANLKLSDF
NIIDTLGVGGFGRVELVQLKSEESKTFAMKILKKRHIVDTRQQEHIRSEKQIMQGAHSDF
IVRLYRTFKDSKYLYMLMEACLGGELWTILRDRGSFEDSTTRFYTACVVEAFAYLHSKGI
IYRDLKPENLILDHRGYAKLVDFGFAKKIGFGKKTWTFCGTPEYVAPEIILNKGHDISAD
YWSLGILMYELLTGSPPFSGPDPMKTYNIILRGIDMIEFPKKIAKNAANLIKKLCRDNPS
ERLGNLKNGVKDIQKHKWFEGFNWEGLRKGTLTPPIIPSVASPTDTSNFDSFPEDNDEPP
PDDNSGWDIDF
NT seq 2016 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagctagaggaagactttgccaagattctcatgctcaaggaggagaggatcaaa
gagctggagaagcggctgtcagagaaggaggaagaaattcaggagctgaagaggaaactc
cacaaatgccagtcggtgctcccagtgccctcgacccacatcggcccccggaccacccgg
gcgcagggcatctcggccgagccgcagacgtacaggtccttccacgacctccgacaggca
ttccggaagttcaccaagtccgaaaggtccaaggatcttataaaggaagctatccttgac
aatgactttatgaagaacttggagctgtcacagatccaggagattgtggattgtatgtac
ccggtggagtatggcaaggacagttgcatcatcaaagaaggagacgtggggtcactggtg
tatgtcatggaagatggtaaggttgaagttacaaaagaaggtgtgaagttgtgtaccatg
ggtccaggaaaagtgtttggggaattggctattctttacaactgtacccggacagcgacc
gtcaagactcttgtaaatgtaaaactctgggccattgatcgacaatgttttcaaacaata
atgatgaggacaggactcatcaagcataccgagtatatggaatttttaaaaagtgttcca
acattccagagccttcctgaagagatcctcagcaagctcgctgatgtccttgaagagacc
cactatgaaaatggagaatatattatcaggcaaggtgcaagaggggacaccttctttatc
atcagcaaaggaacggtaaatgtcactcgtgaagactcaccgagtgaagacccagtcttt
cttagaactttaggaaaaggagactggtttggagagaaagccttgcagggggaagatgtg
agaacagcaaacgtaattgctgcagaagctgtaacctgccttgtgattgacagagactct
ttcaaacatttgattggagggctggatgatgtttctaataaagcatatgaagatgcagaa
gctaaagcaaaatatgaagctgaagcggctttcttcgccaacctgaagctgtctgatttc
aacatcattgatacccttggagttggaggtttcggacgagtagaactggtccagttgaaa
agtgaagaatccaaaacgtttgcaatgaagattctcaagaaacgtcacattgtggacaca
agacagcaggagcacatccgctcagagaagcagatcatgcagggggctcattccgatttc
atagtaagactgtacagaacatttaaggacagcaaatatttgtatatgttgatggaagct
tgtctaggtggagagctctggaccattctcagggatagaggttcgtttgaagattctaca
accagattttacacagcatgtgtggtagaagcttttgcctatctgcattccaaaggaatc
atttacagggacctcaagccagaaaatctcatcctagatcaccgaggttatgccaaactg
gttgattttggctttgcaaagaaaataggatttggaaagaaaacatggactttttgtggg
actccagagtatgtagccccagagatcatcctgaacaaaggccatgacatttcagccgac
tactggtcactgggaatcctaatgtatgaactcctgactggcagcccacctttctcaggc
ccagatcctatgaaaacctataacatcatattgagggggattgacatgatagaatttcca
aagaagattgccaaaaatgctgctaatttaattaaaaaactatgcagggacaatccatca
gaaagattagggaatttgaaaaatggagtaaaagacattcaaaagcacaaatggtttgag
ggctttaactgggaaggcttaagaaaaggtaccttgacacctcctataataccaagtgtt
gcatcacccacagacacaagtaattttgacagtttccctgaggacaacgatgaaccacca
cctgatgacaactcaggatgggatatagacttctaa

DBGET integrated database retrieval system