KEGG   Pan troglodytes (chimpanzee): 744467Help
Entry
744467            CDS       T01005                                 

Gene name
PRKG1
Definition
protein kinase, cGMP-dependent, type I
Orthology
K07376  
protein kinase, cGMP-dependent [EC:2.7.11.12]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
cGMP-PKG signaling pathway
Gap junction
Platelet activation
Circadian entrainment
Long-term depression
Olfactory transduction
Salivary secretion
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Environmental Information Processing
  Signal transduction
   04022 cGMP - PKG signaling pathway
    744467 (PRKG1)
 Cellular Processes
  Cell communication
   04540 Gap junction
    744467 (PRKG1)
 Organismal Systems
  Immune system
   04611 Platelet activation
    744467 (PRKG1)
  Digestive system
   04970 Salivary secretion
    744467 (PRKG1)
  Nervous system
   04730 Long-term depression
    744467 (PRKG1)
  Sensory system
   04740 Olfactory transduction
    744467 (PRKG1)
  Environmental adaptation
   04713 Circadian entrainment
    744467 (PRKG1)
Enzymes [BR:ptr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.12  cGMP-dependent protein kinase
     744467 (PRKG1)
Protein kinases [BR:ptr01001]
 Serine/threonine protein kinases: AGC group
  PKG family
   744467 (PRKG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
10
AA seq 671 aa AA seqDB search
MSELEEDFAKILMLKEERIKELEKRLSEKEEEIQELKRKLHKCQSVLPVPSTHIGPRTTR
AQGISAEPQTYRSFHDLRQAFRKFTKSERSKDLIKEAILDNDFMKNLELSQIQEIVDCMY
PVEYGKDSCIIKEGDVGSLVYVMEDGKVEVTKEGVKLCTMGPGKVFGELAILYNCTRTAT
VKTLVNVKLWAIDRQCFQTIMMRTGLIKHTEYMEFLKSVPTFQSLPEEILSKLADVLEET
HYENGEYIIRQGARGDTFFIISKGTVNVTREDSPSEDPVFLRTLGKGDWFGEKALQGEDV
RTANVIAAEAVTCLVIDRDSFKHLIGGLDDVSNKAYEDAEAKAKYEAEAAFFANLKLSDF
NIIDTLGVGGFGRVELVQLKSEESKTFAMKILKKRHIVDTRQQEHIRSEKQIMQGAHSDF
IVRLYRTFKDSKYLYMLMEACLGGELWTILRDRGSFEDSTTRFYTACVVEAFAYLHSKGI
IYRDLKPENLILDHRGYAKLVDFGFAKKIGFGKKTWTFCGTPEYVAPEIILNKGHDISAD
YWSLGILMYELLTGSPPFSGPDPMKTYNIILRGIDMIEFPKKIAKNAANLIKKLCRDNPS
ERLGNLKNGVKDIQKHKWFEGFNWEGLRKGTLTPPIIPSVASPTDTSNFDSFPEDNDEPP
PDDNSGWDIDF
NT seq 2016 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagctagaggaagactttgccaagattctcatgctcaaggaggagaggatcaaa
gagctggagaagcggctgtcagagaaggaggaagaaattcaggagctgaagaggaaactc
cacaaatgccagtcggtgctcccagtgccctcgacccacatcggcccccggaccacccgg
gcgcagggcatctcggccgagccgcagacgtacaggtccttccacgacctccgacaggca
ttccggaagttcaccaagtccgaaaggtccaaggatcttataaaggaagctatccttgac
aatgactttatgaagaacttggagctgtcacagatccaggagattgtggattgtatgtac
ccggtggagtatggcaaggacagttgcatcatcaaagaaggagacgtggggtcactggtg
tatgtcatggaagatggtaaggttgaagttacaaaagaaggtgtgaagttgtgtaccatg
ggtccaggaaaagtgtttggggaattggctattctttacaactgtacccggacagcgacc
gtcaagactcttgtaaatgtaaaactctgggccattgatcgacaatgttttcaaacaata
atgatgaggacaggactcatcaagcataccgagtatatggaatttttaaaaagtgttcca
acattccagagccttcctgaagagatcctcagcaagctcgctgatgtccttgaagagacc
cactatgaaaatggagaatatattatcaggcaaggtgcaagaggggacaccttctttatc
atcagcaaaggaacggtaaatgtcactcgtgaagactcaccgagtgaagacccagtcttt
cttagaactttaggaaaaggagactggtttggagagaaagccttgcagggggaagatgtg
agaacagcaaacgtaattgctgcagaagctgtaacctgccttgtgattgacagagactct
ttcaaacatttgattggagggctggatgatgtttctaataaagcatatgaagatgcagaa
gctaaagcaaaatatgaagctgaagcggctttcttcgccaacctgaagctgtctgatttc
aacatcattgatacccttggagttggaggtttcggacgagtagaactggtccagttgaaa
agtgaagaatccaaaacgtttgcaatgaagattctcaagaaacgtcacattgtggacaca
agacagcaggagcacatccgctcagagaagcagatcatgcagggggctcattccgatttc
atagtaagactgtacagaacatttaaggacagcaaatatttgtatatgttgatggaagct
tgtctaggtggagagctctggaccattctcagggatagaggttcgtttgaagattctaca
accagattttacacagcatgtgtggtagaagcttttgcctatctgcattccaaaggaatc
atttacagggacctcaagccagaaaatctcatcctagatcaccgaggttatgccaaactg
gttgattttggctttgcaaagaaaataggatttggaaagaaaacatggactttttgtggg
actccagagtatgtagccccagagatcatcctgaacaaaggccatgacatttcagccgac
tactggtcactgggaatcctaatgtatgaactcctgactggcagcccacctttctcaggc
ccagatcctatgaaaacctataacatcatattgagggggattgacatgatagaatttcca
aagaagattgccaaaaatgctgctaatttaattaaaaaactatgcagggacaatccatca
gaaagattagggaatttgaaaaatggagtaaaagacattcaaaagcacaaatggtttgag
ggctttaactgggaaggcttaagaaaaggtaccttgacacctcctataataccaagtgtt
gcatcacccacagacacaagtaattttgacagtttccctgaggacaacgatgaaccacca
cctgatgacaactcaggatgggatatagacttctaa

DBGET integrated database retrieval system