KEGG   Pan troglodytes (chimpanzee): 744779Help
Entry
744779            CDS       T01005                                 

Gene name
CYCS
Definition
(RefSeq) cytochrome c
  KO
K08738  cytochrome c
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr01100  Metabolic pathways
ptr01524  Platinum drug resistance
ptr04115  p53 signaling pathway
ptr04210  Apoptosis
ptr04215  Apoptosis - multiple species
ptr04932  Non-alcoholic fatty liver disease (NAFLD)
ptr05010  Alzheimer's disease
ptr05012  Parkinson's disease
ptr05014  Amyotrophic lateral sclerosis (ALS)
ptr05016  Huntington's disease
ptr05134  Legionellosis
ptr05145  Toxoplasmosis
ptr05152  Tuberculosis
ptr05161  Hepatitis B
ptr05164  Influenza A
ptr05167  Kaposi's sarcoma-associated herpesvirus infection
ptr05168  Herpes simplex infection
ptr05200  Pathways in cancer
ptr05210  Colorectal cancer
ptr05222  Small cell lung cancer
ptr05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    744779 (CYCS)
   04215 Apoptosis - multiple species
    744779 (CYCS)
   04115 p53 signaling pathway
    744779 (CYCS)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    744779 (CYCS)
   05210 Colorectal cancer
    744779 (CYCS)
   05222 Small cell lung cancer
    744779 (CYCS)
  Neurodegenerative diseases
   05010 Alzheimer's disease
    744779 (CYCS)
   05012 Parkinson's disease
    744779 (CYCS)
   05014 Amyotrophic lateral sclerosis (ALS)
    744779 (CYCS)
   05016 Huntington's disease
    744779 (CYCS)
  Cardiovascular diseases
   05416 Viral myocarditis
    744779 (CYCS)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    744779 (CYCS)
  Infectious diseases
   05134 Legionellosis
    744779 (CYCS)
   05152 Tuberculosis
    744779 (CYCS)
   05164 Influenza A
    744779 (CYCS)
   05161 Hepatitis B
    744779 (CYCS)
   05168 Herpes simplex infection
    744779 (CYCS)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    744779 (CYCS)
   05145 Toxoplasmosis
    744779 (CYCS)
  Drug resistance
   01524 Platinum drug resistance
    744779 (CYCS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550
Motif
Other DBs
NCBI-GeneID: 744779
NCBI-ProteinID: NP_001065289
Ensembl: ENSPTRG00000018996
UniProt: P99998 K7CAI8
Position
7
AA seq 105 aa AA seqDB search
MGDVEKGKKIFIMKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGYSYTAANKNKGIIW
GEDTLMEYLENPKKYIPGTKMIFVGIKKKEERADLIAYLKKATNE
NT seq 318 nt NT seq  +upstreamnt  +downstreamnt
atgggtgatgttgagaaaggcaagaagatttttattatgaagtgttcccagtgccatacc
gttgaaaagggaggcaagcacaagactgggccaaatctccatggtctcttcgggcggaag
acaggtcaggcccctggatattcttacacagccgccaataagaacaaaggcatcatctgg
ggagaggatacactgatggagtatttggagaatcccaagaagtacatccctggaacaaaa
atgatatttgtcggcattaagaagaaggaagaaagggcagacttaatagcttatctcaaa
aaagctactaatgagtaa

DBGET integrated database retrieval system