KEGG   Pan troglodytes (chimpanzee): 744970Help
Entry
744970            CDS       T01005                                 

Gene name
ZRANB2
Definition
zinc finger, RAN-binding domain containing 2
Organism
ptr  Pan troglodytes (chimpanzee)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
1
AA seq 330 aa AA seqDB search
MSTKNFRVSDGDWICPDKKCGNVNFARRTSCNRCGREKTTEAKMMKAGGTEIGKTLAEKS
RGLFSANDWQCKTCSNVNWARRSECNMCNTPKYAKLEERTGYGGGFNERENVEYIEREES
DGEYDEFGRKKKKYRGKAVGPASILKEVEDKESEGEEEDEDEDLSKYKLDEDEDEDDADL
SKYNLDASEEEDSNKKKSNRRSRSKSRSSHSRSSSRSSSPSSSRSRSRSRSRSSSSSQSR
SRSSSRERSRSRGSKSRSSSRSHRGSSSPRKRSYSSSSSSPERNRKRSRSRSSSSGDRKK
RRTRSRSPERRHRSSSGSSHSGSRSSSKKK
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaccaagaatttccgagtcagtgacggggactggatttgccctgacaaaaaatgt
ggaaatgtaaactttgctagaagaaccagctgtaatcgatgtggtcgggagaaaacaact
gaggccaagatgatgaaagctgggggcactgaaataggaaagacacttgccgaaaagagc
cgaggcctatttagtgctaatgactggcaatgtaaaacttgcagcaatgtgaattgggcc
agaagatcagagtgtaatatgtgtaatactccaaagtatgctaaattagaagaaagaaca
ggatatggtggtggttttaatgaaagagaaaatgttgaatatatagaaagagaagaatct
gatggtgaatatgatgagtttggacgtaaaaagaaaaaatacagagggaaagcagttggt
cctgcatctatattaaaggaagttgaagataaagaatcagagggagaagaagaggatgag
gatgaagatctttctaaatataagttagatgaggatgaggatgaagatgatgctgatctc
tcaaaatataatcttgatgccagtgaagaagaagatagtaataaaaagaaatctaataga
cgaagtcgctcaaagtctcgatcttcacattcacgatcttcatcacgctcatcctccccc
tcaagttcaaggtctaggtccaggtcccgttcaagaagttcttccagttcgcagtcaaga
tctcgttccagttccagagaacgttcgagatctcgtgggtcgaaatcaagatccagctcc
aggtcccacaggggctcttcttccccacgaaaaagatcttattcaagttcatcatcttct
cctgagaggaacagaaagagaagtcgttctagatcttcttcatctggtgatcgcaaaaaa
agacgaacaagatcacggtcacccgaaagacgccacaggtcatcatctggatcatcccat
tctggttcccgttcaagttcaaaaaagaaataa

DBGET integrated database retrieval system