KEGG   Pan troglodytes (chimpanzee): 745019Help
Entry
745019            CDS       T01005                                 

Definition
cytochrome c-like
Orthology
K08738  
cytochrome c
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
Sulfur metabolism
Metabolic pathways
p53 signaling pathway
Apoptosis
Non-alcoholic fatty liver disease (NAFLD)
Alzheimer's disease
Parkinson's disease
Amyotrophic lateral sclerosis (ALS)
Huntington's disease
Legionellosis
Toxoplasmosis
Tuberculosis
Hepatitis B
Influenza A
Herpes simplex infection
Pathways in cancer
Colorectal cancer
Small cell lung cancer
Viral myocarditis
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    745019
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    745019
   04115 p53 signaling pathway
    745019
 Human Diseases
  Cancers
   05200 Pathways in cancer
    745019
   05210 Colorectal cancer
    745019
   05222 Small cell lung cancer
    745019
  Neurodegenerative diseases
   05010 Alzheimer's disease
    745019
   05012 Parkinson's disease
    745019
   05014 Amyotrophic lateral sclerosis (ALS)
    745019
   05016 Huntington's disease
    745019
  Cardiovascular diseases
   05416 Viral myocarditis
    745019
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    745019
  Infectious diseases
   05134 Legionellosis
    745019
   05152 Tuberculosis
    745019
   05164 Influenza A
    745019
   05161 Hepatitis B
    745019
   05168 Herpes simplex infection
    745019
   05145 Toxoplasmosis
    745019
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
16
AA seq 102 aa AA seqDB search
MGDVEKSKKIFVQKCAQCHTVEKGGKHKTGPNLFRWKTGQAIGFSYTDTSKNKGITWGED
TLMEYLENPKKYIPGTKMIFAGIKKEAERADFIAYLKKATNE
NT seq 309 nt NT seq  +upstreamnt  +downstreamnt
atgggtgatgttgagaaaagcaagaagatttttgttcagaagtgtgcccagtgccacacc
gtggaaaagggaggcaagcataagacagggcctaatctcttcaggtggaagacaggtcag
gccattggattctcttacacagacaccagtaagaacaaaggcatcacctggggagaggat
acactgatggagtatttggagaatcccaagaagtacatccctggaacaaaaatgatcttt
gccggcattaagaaggaggcagaaagggcagactttatagcttatctcaaaaaagctact
aatgagtaa

DBGET integrated database retrieval system