KEGG   Pan troglodytes (chimpanzee): 745027Help
Entry
745027            CDS       T01005                                 

Gene name
GALM
Definition
galactose mutarotase (aldose 1-epimerase)
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Module
Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:ptr00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:ptr00052]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2A
AA seq 221 aa AA seqDB search
MASVTRAVFGELPSGGGTVEKFQLQSDLLRVDIISWGCTITALEVKDRQGRASDVVLGFA
ELEGYLQKQPYFGAVIGRVANRIAKGTFKVDGKEYHLAINKEPNSLHGGVRGFDKVLWTP
RVLSNGVQFSRISPDGEEGYPGELKVWVTYTLDGGELIVNYRAQASQATPVNLTNHSYFN
LAGQGSPNIYDHEVTIEADTYLPVDETLIPTGGTNRRFLQG
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atggcttcggtgaccagggccgtgtttggagagctgccctcgggaggagggacagtggag
aagttccagctgcagtcagacctcttgagagtggacatcatctcctggggctgcacgatc
acagccctagaggtcaaagacaggcaggggagagcctcggacgtggtgcttggcttcgcc
gagttggaaggatacctccaaaagcagccatactttggagcagttattgggagggtggcc
aaccgaatcgccaaaggaaccttcaaggtggatgggaaggagtatcacctggccattaac
aaggaacccaacagtctgcatggaggagtcagagggtttgataaagtgctctggacccct
cgggtgctgtcaaatggcgtccagttctcgcgcatcagtccagatggtgaagaaggctac
cccggagagttaaaagtctgggtgacatacaccctggatggcggagagctcatagtcaac
tacagagcacaagccagtcaggccacaccagtcaacctgaccaaccattcttacttcaac
ctggcaggccagggttcccccaatatatatgaccatgaagtcaccatagaagcggatact
tatttgcctgtggatgaaaccctgattcctacaggtggcaccaacagaaggtttctgcaa
ggctga

DBGET integrated database retrieval system