KEGG   Pan troglodytes (chimpanzee): 745345Help
Entry
745345            CDS       T01005                                 

Definition
(RefSeq) steroid 21-hydroxylase
  KO
K00513  
steroid 21-monooxygenase [EC:1.14.14.16]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
Steroid hormone biosynthesis
Metabolic pathways
Aldosterone synthesis and secretion
Module
C21-Steroid hormone biosynthesis, progesterone => corticosterone/aldosterone
C21-Steroid hormone biosynthesis, progesterone => cortisol/cortisone
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    745345
 Organismal Systems
  Endocrine system
   04925 Aldosterone synthesis and secretion
    745345
Enzymes [BR:ptr01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.16  steroid 21-monooxygenase
     745345
Cytochrome P450 [BR:ptr00199]
 Cytochrome P450, animal type
  CYP21 family
   745345
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
6
AA seq 495 aa AA seqDB search
MLLLGLLLLLPLLAGARLLWNWWKLRSLHLPPLAPGFLHLLQPDLPIYLLGLTQKFGPIY
RLHLGLQDVVVLNSKRTIEEAMVKKWADFAGRPEPLTYKLVSKNYPDLSLGDYSLLWKAH
KKLTRSALLLGIRDSMEPVVEQLTQEFCERMRAQPGTPVAIEEEFSLLTCSIICYLTFGD
KIKEDNLMPAYYKCIQEVLKTWSHWSIQIVDVIPFLRFFPNPGLRRLKQAIEKRDHIVEK
QLRQHKASLVAGQWRDMMDYMLQGVAQPSMEEGSGQLLEGHVHMAAVDLLIGGTETTANT
LSWAVVFLLHHPEIQQRLQEELDHELGPGASSSRVPYKDRARLPLLNATIAEVLRLRPVV
PLALPHRTTRPSSISGYDIPEGTVIIPNLQGAHLDETVWERPHEFWPDRFLEPGKNSRAL
AFGCGARVCLGEPLARLELFVVLTRLLQAFTLLPSGDALPSLQPLPHCSVILKMQPFQVR
LQPRGMGAHSPGQSQ
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgctgctcctgggcctgctgctgctgctgcccctgctggctggcgcccgcctgctgtgg
aactggtggaagctccggagcctccacctcccgcctcttgccccgggcttcttgcacctg
ctgcagcctgacctccccatctatctgcttggcctgactcagaaattcgggcccatctac
aggctccaccttgggctgcaagatgtggtggtgctgaactccaagaggaccattgaggaa
gccatggtcaaaaagtgggcagactttgctggcagacctgagccacttacctacaagctg
gtgtctaagaactacccggacctgtccttgggagactactccctgctctggaaagcccac
aagaagctcacccgctcagccctgctgctgggcatccgtgactccatggagccagtggtg
gagcagctgacccaggagttctgcgagcgcatgagagcccagcccggcacccctgtggcc
attgaggaggaattctctctccttacctgcagcatcatctgttacctcaccttcggagac
aagatcaaggaggacaacttaatgcctgcctattacaaatgtatccaggaggtgttaaaa
acctggagccactggtccatccaaattgtggacgtgattccctttctcaggttcttcccc
aatccaggtctccggaggctgaagcaggccatagagaagagggaccacatcgtggagaag
cagctgaggcagcacaaggcgagcctggtggcaggccagtggagggacatgatggactac
atgctccaaggggtggcgcagccgagcatggaagagggctctggacagctcctggaaggg
cacgtgcacatggctgcagtggacctcctgatcggtggcactgagaccacagcaaacacc
ctctcctgggccgtggtttttttgcttcaccaccctgagattcagcagcgactgcaggag
gagctagaccacgaactgggccctggtgcctccagctcccgggtcccctacaaggaccgt
gcacggctgcccttgctcaatgccaccatcgccgaggtgctgcgcctgcggcccgttgtg
cccttagccttgccccaccgcaccacacggcccagcagcatctccggctacgacatccct
gagggcacagtcatcattccgaacctccaaggcgcccacctggatgagacggtctgggag
aggccacatgagttctggcctgatcgcttcctggagccaggcaagaactccagagctctg
gccttcggctgcggtgcccgcgtgtgcctgggcgagccgctggcgcgcctggagctcttc
gtggtgctgacccgactgctgcaggccttcacgctgctgccctccggggacgccctgccc
tccctgcagcccctgccccactgcagtgtcatcctcaagatgcagcctttccaagtgcgg
ctgcagccccgggggatgggggcccacagcccgggccagagccagtga

DBGET integrated database retrieval system