KEGG   Pan troglodytes (chimpanzee): 745345Help
Entry
745345            CDS       T01005                                 

Definition
steroid 21-hydroxylase-like
Orthology
K00513  
steroid 21-monooxygenase [EC:1.14.99.10]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
Steroid hormone biosynthesis
Metabolic pathways
Module
C21-Steroid hormone biosynthesis, progesterone => corticosterone/aldosterone
C21-Steroid hormone biosynthesis, progesterone => cortisol/cortisone
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    745345
Enzymes [BR:ptr01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.10  steroid 21-monooxygenase
     745345
Cytochrome P450 [BR:ptr00199]
 Cytochrome P450, animal type
  CYP21 family
   745345
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
6
AA seq 495 aa AA seqDB search
MLLLGLLLLLPLLAGARLLWNWWKLRSLHLPPLAPGFLHLLQPDLPIYLLGLTQKFGPIY
RLHLGLQDVVVLNSKRTIEEAMVKKWADFAGRPEPLTYKLVSKNYPDLSLGDYSLLWKAH
KKLTRSALLLGIRDSMEPVVEQLTQEFCERMRAQPGTPVAIEEEFSLLTCSIICYLTFGD
KIKEDNLMPAYYKCIQEVLKTWSHWSIQIVDVIPFLRFFPNPGLRRLKQAIEKRDHIVEK
QLRQHKASLVAGQWRDMMDYMLQGVAQPSMEEGSGQLLEGHVHMAAVDLLIGGTETTANT
LSWAVVFLLHHPEIQQRLQEELDHELGPGASSSRVPYKDRARLPLLNATIAEVLRLRPVV
PLALPHRTTRPSSISGYDIPEGTVIIPNLQGAHLDETVWERPHEFWPDRFLEPGKNSRAL
AFGCGARVCLGEPLARLELFVVLTRLLQAFTLLPSGDALPSLQPLPHCSVILKMQPFQVR
LQPRGMGAHSPGQSQ
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgctgctcctgggcctgctgctgctgctgcccctgctggctggcgcccgcctgctgtgg
aactggtggaagctccggagcctccacctcccgcctcttgccccgggcttcttgcacctg
ctgcagcctgacctccccatctatctgcttggcctgactcagaaattcgggcccatctac
aggctccaccttgggctgcaagatgtggtggtgctgaactccaagaggaccattgaggaa
gccatggtcaaaaagtgggcagactttgctggcagacctgagccacttacctacaagctg
gtgtctaagaactacccggacctgtccttgggagactactccctgctctggaaagcccac
aagaagctcacccgctcagccctgctgctgggcatccgtgactccatggagccagtggtg
gagcagctgacccaggagttctgcgagcgcatgagagcccagcccggcacccctgtggcc
attgaggaggaattctctctccttacctgcagcatcatctgttacctcaccttcggagac
aagatcaaggaggacaacttaatgcctgcctattacaaatgtatccaggaggtgttaaaa
acctggagccactggtccatccaaattgtggacgtgattccctttctcaggttcttcccc
aatccaggtctccggaggctgaagcaggccatagagaagagggaccacatcgtggagaag
cagctgaggcagcacaaggcgagcctggtggcaggccagtggagggacatgatggactac
atgctccaaggggtggcgcagccgagcatggaagagggctctggacagctcctggaaggg
cacgtgcacatggctgcagtggacctcctgatcggtggcactgagaccacagcaaacacc
ctctcctgggccgtggtttttttgcttcaccaccctgagattcagcagcgactgcaggag
gagctagaccacgaactgggccctggtgcctccagctcccgggtcccctacaaggaccgt
gcacggctgcccttgctcaatgccaccatcgccgaggtgctgcgcctgcggcccgttgtg
cccttagccttgccccaccgcaccacacggcccagcagcatctccggctacgacatccct
gagggcacagtcatcattccgaacctccaaggcgcccacctggatgagacggtctgggag
aggccacatgagttctggcctgatcgcttcctggagccaggcaagaactccagagctctg
gccttcggctgcggtgcccgcgtgtgcctgggcgagccgctggcgcgcctggagctcttc
gtggtgctgacccgactgctgcaggccttcacgctgctgccctccggggacgccctgccc
tccctgcagcccctgccccactgcagtgtcatcctcaagatgcagcctttccaagtgcgg
ctgcagccccgggggatgggggcccacagcccgggccagagccagtga

DBGET integrated database retrieval system