KEGG   Pan troglodytes (chimpanzee): 745516Help
Entry
745516            CDS       T01005                                 

Gene name
RARB
Definition
retinoic acid receptor, beta
Orthology
K08528  
retinoic acid receptor beta
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
Pathways in cancer
Small cell lung cancer
Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Human Diseases
  Cancers
   05200 Pathways in cancer
    745516 (RARB)
   05222 Small cell lung cancer
    745516 (RARB)
   05223 Non-small cell lung cancer
    745516 (RARB)
Transcription factors [BR:ptr03000]
 Eukaryotic Type
  Zinc finger
   Cys4 thyroid hormone-like
    745516 (RARB)
Nuclear receptors [BR:ptr03310]
 1. Thyroid hormone like
  1B. Retinoic acid receptor (RAR)
   745516 (RARB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
3
AA seq 336 aa AA seqDB search
MIYTCHRDKNCVINKVTRNRCQYCRLQKCFEVGMSKESVRNDRNKKKKETSKQECTESYE
MTAELDDLTEKIRKAHQETFPSLCQLGKYTTNSSADHRVRLDLGLWDKFSELATKCIIKI
VEFAKRLPGFTGLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHN
AGFGPLTDLVFTFANQLLPLEMDDTETGLLSAICLICGDRQDLEEPTKVDKLQEPLLEAL
KIYIRKRRPSKPHMFPKILMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEG
HEPLTPSSSGNTAEHSPSISPSSVENSGVSQSPLVQ
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgatttacacttgtcaccgagataagaactgtgttattaataaagtcaccaggaatcga
tgccaatactgtcgactccagaagtgctttgaagtgggaatgtccaaagaatctgtcagg
aatgacaggaacaagaaaaagaaggagacttcgaagcaagaatgcacagagagctatgaa
atgacagctgagttggacgatctcacagagaagatccgaaaagctcaccaggaaactttc
ccttcactctgccagctgggtaaatacaccacgaattccagtgctgaccatcgagtccgt
ctggacctgggcctctgggacaaattcagtgaactggccaccaagtgcattattaagatc
gtggagtttgctaaacgtctgcctggtttcactggcttgaccatcgcagaccaaattacc
ctgctgaaggccgcctgcctggacatcctgattcttagaatttgcaccaggtatacccca
gaacaagacaccatgactttctcagacggccttaccctaaatcgaactcagatgcacaat
gctggatttggtcctctgactgaccttgtgttcacctttgccaaccagctcctgcctttg
gaaatggatgacacagaaacaggccttctcagtgccatctgcttaatctgtggagaccgc
caggaccttgaggaaccgacaaaagtagataagctacaggaaccattgctggaagcacta
aaaatttatatcagaaaaagacgacccagcaagcctcacatgtttccaaagatcttaatg
aaaatcacagatctccgtagcatcagtgctaaaggtgcagagcgtgtaattaccttgaaa
atggaaattcctggatcaatgccacctctcattcaagaaatgctggagaattctgaagga
catgaacccttgaccccaagttcaagtgggaacacagcagagcacagtcctagcatctca
cccagctcagtggaaaacagtggggtcagtcagtcaccactcgtgcaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system