KEGG   Pan troglodytes (chimpanzee): 745680Help
Entry
745680            CDS       T01005                                 

Gene name
PDIA5
Definition
protein disulfide isomerase family A, member 5
Orthology
K09583  
protein disulfide isomerase family A, member 5 [EC:5.3.4.1]
Organism
ptr  Pan troglodytes (chimpanzee)
Brite
Enzymes [BR:ptr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     745680 (PDIA5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
3
AA seq 519 aa AA seqDB search
MARAGPAWLLLAIWVVLPSWLSSAKVSSLIERISDPKDLKKLLRTRNNVLVLYSKSEAAA
ENHLRLLSTVAQVVKGQGTICWVDCGDAESRKLCKKMKVDLSPKDKKVELFHYQDGAFHT
EYNRAVTFKSIVAFLKDPKGPPLWEEDPGAKDVVHLDSEKDFRRLLKKEEKPLLIMFYAP
WCSMCKRMMPHFQKAATQLRGHAVLAGMNVYSSEFENIKEEYSVRGFPTICYFEKGRFLF
QYDNYGSTSEDIVEWLKNPQPPQPQVPETPWADEGGSVYHLTDEDFDQFVKEHSSVLVMF
HAPWCGHCKKMKPEFEKAAEALHGEADSSGVLAAVDATVNKALAERFHISEFPTLKYFKN
GEKYAVPVLRTKKKFLEWMQNPEAPPPPEPTWEEQQTSVLHLVGDNFRETLKKKKHTLVM
FYAPWCPHCKKVIPHFTATADAFKDDRKIACAAVDCVKDKNQDLCQQEAVKGYPTFHYYH
YGKFAEKYDSDRTELGFTNYIRALREGDHERLGKKKEEL
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atggcgcgggccgggccggcgtggctgctgctggcaatctgggtggtcctgccatcatgg
ctgtcctctgcaaaggtctcctcgctcattgagagaatctctgaccccaaggacttgaaa
aaactgctcagaacccggaataatgtactggtgctttactccaaatctgaggcggcagct
gaaaatcatctcaggttactgtccacagtggcccaggtggtgaaaggacaagggaccatc
tgctgggtggactgtggtgatgcagagagtagaaaattgtgcaagaagatgaaagttgac
ctgagcccgaaggacaaaaaggtcgaattattccattaccaggatggtgcatttcatact
gaatataaccgagctgtgacatttaagtccatagtggcctttttgaaggatccaaaaggg
cccccactgtgggaggaagatcctggagccaaagatgttgtccaccttgacagtgaaaag
gacttcagacggctcctgaagaaggaagagaagccgctcctgatcatgttttatgccccc
tggtgcagcatgtgcaagaggatgatgccgcatttccagaaggctgcgactcagctgcgg
ggccacgccgtgctggccgggatgaatgtctactcctctgaatttgaaaacatcaaggag
gagtacagcgtgcgcggcttccccaccatctgctattttgagaaaggacggttcttgttc
cagtatgacaactatgggtccacatctgaggacattgtggagtggctgaagaatccgcag
ccgccacagccccaggtccctgagactccctgggcagatgagggcggctccgtttatcac
ctgaccgatgaagactttgaccagtttgtgaaggaacactcctctgtcctcgtcatgttc
cacgccccatggtgtggccactgtaagaaaatgaagccggagtttgagaaggcagcagaa
gccctccatggagaagcggatagctctggtgtccttgcagctgtcgatgccactgtcaac
aaggccctggcagaaagattccacatctcagagtttcctacgttgaagtattttaagaat
ggagagaaatacgcagtgcccgtgctcaggacaaagaagaagtttctcgagtggatgcaa
aaccctgaggcccccccacccccagagcccacgtgggaagagcagcagacaagcgtgttg
cacctggtgggggacaacttccgggagaccctgaagaagaagaaacacaccttggtcatg
ttctacgccccttggtgcccacactgtaagaaggtcattccgcactttactgctactgct
gatgccttcaaagatgaccgaaagattgcctgtgctgctgttgactgtgtcaaagacaag
aaccaagacctgtgccagcaggaggcggtcaagggctaccccactttccactactaccac
tatgggaagttcgcagaaaagtatgacagcgaccgcacagaattgggatttaccaattat
attcgagccctccgggagggagaccatgaaagactagggaaaaagaaggaagagttataa

DBGET integrated database retrieval system