KEGG   Pan troglodytes (chimpanzee): 745942Help
Entry
745942            CDS       T01005                                 

Gene name
CDKN2D
Definition
cyclin-dependent kinase inhibitor 2D (p19, inhibits CDK4)
Orthology
K06623  
cyclin-dependent kinase inhibitor 2D
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
FoxO signaling pathway
Cell cycle
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    745942 (CDKN2D)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    745942 (CDKN2D)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
19
AA seq 166 aa AA seqDB search
MLLEEVRAGDRLSGAAARGDVQEVRRLLHRELVHPDALNRFGKTALQVMMFGSTAIALEL
LKQGASPNVQDTSGTSPVHDAARTGFLDTLKVLVEHGADVNVPDGTGALPIHLAVQEGHT
AVVSFLAAESDLHRRDARGLTPLELALQRGAQDLVDILQGHMVAPL
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
atgctgctggaggaggttcgcgccggcgaccggctgagtggggcggcggcccggggcgac
gtgcaggaggtgcgccgccttctgcatcgcgagctggtgcatcccgacgcccttaaccgc
ttcggcaagacggcgctgcaggtcatgatgtttggcagcaccgccatcgccctggagctg
ctgaagcaaggtgccagccccaatgtccaggacacctccggtaccagtccagtccatgac
gcagcccgcactggattcctggacaccctgaaggtcctagtggagcacggggctgatgtc
aacgtgcctgatggcaccggggcacttccaatccatctggcagttcaagagggtcacact
gctgtggtcagctttctggcagctgaatctgatctccatcgcagggacgccaggggtctc
acacccttggagctggcactgcagagaggggctcaggacctcgtggacatcctgcagggc
cacatggtggccccgctgtga

DBGET integrated database retrieval system