KEGG   Pan troglodytes (chimpanzee): 746151Help
Entry
746151            CDS       T01005                                 

Gene name
CDC25C
Definition
cell division cycle 25 homolog C (S. pombe) (EC:3.1.3.48)
Orthology
K05867  
M-phase inducer phosphatase 3 [EC:3.1.3.48]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
Cell cycle
Oocyte meiosis
Progesterone-mediated oocyte maturation
MicroRNAs in cancer
Class
Cellular Processes; Cell growth and death; Cell cycle [PATH:ptr04110]
Cellular Processes; Cell growth and death; Oocyte meiosis [PATH:ptr04114]
Organismal Systems; Endocrine system; Progesterone-mediated oocyte maturation [PATH:ptr04914]
Human Diseases; Cancers; MicroRNAs in cancer [PATH:ptr05206]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
5
AA seq 508 aa AA seqDB search
MEGAAPCRVSLKVSLGQRCWERAWRFDLGMGVVSSLTSHPLQNIAESGRPQLEAHLETRG
GGHVGRRGTPKRCLDLSNLSSGEITATQLTTSADLDETGHLDSSGLQEVHLAGMNHDQHL
MRCSPAQLLCSTPNGLDRGHRKRDAMCSSSANKENENSTLKPLEWQAPRNLRFQKRPGKP
YVSPLSLLDNGNLVDSEIKYLGSPITTVPKLDKNPNLGEDQAEEISDELMEFSLEDQEAK
VSRSGLYRSPSMPENLNRPRLKQVEKFKDNTIPDKVKKKYFSGQGKLRKGLRLKKTVSLC
DINITQMLEEDSNQGHLVGDFSKVCALPTVSGKHQDLKYINPETVAALLSGKFQGLIEKF
YVIDCRYPYEYLGGHIQGALNLYSQEELFNFFLKKPIVPLDTQKRIVIVFHCEFSSERGP
RMCRCLREEDRSLSQYPALYYPELYILKGGYRDFFPEYMELCEPQSYCPMHHQDHKTELL
RCRSQSKVQEGERQLREQIALLVKDMSP
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atggagggcgcagctccgtgtcgtgtctctctcaaagtgtctctcggacagcgctgttgg
gaacgagcctggcgctttgatttagggatgggggtggtttcctcactaacgagtcacccc
ctccaaaatatcgcagaaagtggacggccccagttggaggcacatcttgaaacccgcggg
ggaggccatgtcggaagaagaggaaccccaaaacgttgcctcgatctttcgaatcttagc
agtggggagataactgccactcagcttaccacttctgcagaccttgatgaaactggtcac
ctggattcttcaggacttcaggaagtgcatttagctgggatgaatcatgaccagcaccta
atgagatgtagcccagcacagcttctttgtagcactccgaatggtttggaccgtggccat
agaaagagagatgcaatgtgtagttcatctgcaaataaagaaaatgaaaacagcactttg
aagcccttggagtggcaggcacctaggaacctgaggtttcaaaagagaccaggaaagcct
tatgtgtctcctctttctctgctggacaatggaaacttggtggacagtgaaattaaatat
ctgggcagtcccattactactgttccaaaattggataaaaatccaaacctaggagaagac
caggcagaagagatttcagatgaattaatggagttttccctggaagatcaagaagcaaag
gtgagcagaagtggcctatatcgctccccgtcgatgccagagaacttgaacaggccaaga
ctgaagcaggtggaaaaattcaaggacaacacaataccagataaagttaaaaaaaagtat
ttttctggccaaggaaagctcaggaagggcttacgtttaaagaagacagtctctctgtgt
gacattaatatcactcagatgctggaggaagattctaaccaggggcacctggttggtgat
ttttccaaggtatgtgcgctgccaaccgtgtcagggaaacaccaagatctgaagtatatc
aacccagaaacagtggctgccttactgtcggggaagttccagggtctgattgagaagttt
tatgtcattgattgtcgctatccatatgagtatctgggaggacacatccagggagcctta
aacttatatagtcaggaagaactgtttaacttctttctgaagaagcccatcgtccctttg
gacacccagaagagaatagtcatcgtgttccactgtgaattctcctcagagaggggcccc
cgaatgtgccgctgtctgcgtgaagaggacaggtctctgagccagtatcctgcattgtac
tacccagagctatatatccttaaaggcggctacagagacttctttccagaatatatggaa
ctgtgtgaaccacagagctactgccctatgcatcatcaggaccacaagactgagttgctg
aggtgtcgaagccagagcaaagtgcaggaaggggagcggcagctgcgggagcagattgcc
cttctggtgaaggacatgagcccatga

DBGET integrated database retrieval system