KEGG   Pan troglodytes (chimpanzee): 746712Help
Entry
746712            CDS       T01005                                 

Gene name
MAPK15
Definition
(RefSeq) mitogen-activated protein kinase 15 isoform X2
  KO
K19603  mitogen-activated protein kinase 15 [EC:2.7.11.24]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr04657  IL-17 signaling pathway
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Organismal Systems
  Immune system
   04657 IL-17 signaling pathway
    746712 (MAPK15)
Enzymes [BR:ptr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     746712 (MAPK15)
Protein kinases [BR:ptr01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   746712 (MAPK15)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Haspin_kinase Kinase-like Kdo
Motif
Other DBs
NCBI-GeneID: 746712
NCBI-ProteinID: XP_016815523
Ensembl: ENSPTRG00000020666
Position
8
AA seq 634 aa AA seqDB search
MCTAVDPRIVRRYLLRRQLGQGAYGIVWKAVDRRTGEVVAIKKIFDAFRDKTDAQRTFRE
ITLLQEFGDHPNIISLLDVVRAENDRDIYLVFEFMDTDLNAVIRKGGLLQDVHVRSIFYQ
LLRATRFLHSGQVVHRDQKPSNVLLDANCTVKLCDFGLARSLGDLPEGPEDQAVTEYVAT
RWYRAPEVLLSSHRYTLGVDMWSLGCILGEMLRGRPLFPGTSTLHQLELILETIPPPSEE
DLLALGSGCRASVLHHLGSRPRQTLDALLPPDTSPEALDLLRRLLVFAPDKRLSATQALQ
HPYVQRFHCPSDEWAREADVRPRAHEGVQLSVPEYRSRVYQMILECGGSSGTSREKGPEG
VSPSQAHLHKPRADPQLPSRTPVQGPRPRPQSSPGHDPAEHESPRAAKNVPRQNSAPLLQ
TALLGNGERPLGAKEAPPLTLSLVKPSGRGAAPSLTSQAAAQVANQALIRGDWNRGGGVR
VASAQQVSPAQSAPIPSSSFPLSPCFSLPSPCFPLPLQCPVQISRGPQGLPSTAPPLMAP
LCDPQLYTGPSPASSGGPARPEDVQHLCLAGCPGGCQGFAWRLLPSLRDCLPLCTGPPAP
AGGAPCVSRPTPFTWPSVPAPAPSPDPSPVSCTP
NT seq 1905 nt NT seq  +upstreamnt  +downstreamnt
atgtgcaccgcagtggaccctcgcattgtccggagatacctactcaggcggcagctcggg
cagggggcctatggcattgtgtggaaggcagtggaccggaggactggtgaggtcgtggcc
atcaagaaaatctttgatgcttttagggataagacagatgcccagagaacattccgggaa
atcacgctcctccaggagtttggggaccatcccaacatcatcagcctccttgacgtggtc
cgggcagagaacgacagggacatttacctggtgtttgagtttatggacactgacctgaac
gcagtcatccggaagggcggcctgctgcaggacgtccacgtgcgctccatcttctaccag
ctcctgcgggccacccggttcctccactcggggcaggttgtgcaccgggaccagaagccg
tccaatgtgctcctggatgccaactgcacagtgaagctgtgtgactttggcctggcccgc
tccctgggcgacctccctgaggggcctgaggaccaggccgtgacagagtacgtggccaca
cgctggtaccgagcaccggaggtgctgctctcttcgcaccgatacacccttggggtggac
atgtggagtctgggctgtatccttggggagatgctgcgggggagacccctgttcccgggc
acgtccaccctccaccagctggagctgatcctggagaccatcccaccgccatctgaggag
gacctcctggctctcggctcaggctgccgtgcctctgtgctgcaccacctggggtcccgg
ccacgacagacgctggatgccctcctaccgccagacacctccccagaggccttggacctc
cttaggcgactcctggtgttcgccccggacaagcggttaagtgcgacccaggcactgcag
cacccctacgtgcagaggttccactgccccagcgacgagtgggcacgagaggcagatgtg
cggccccgggcacacgaaggggtccagctctctgtgcctgagtaccgcagccgcgtctat
cagatgatcctggagtgtggaggcagcagcggcacctcgagagagaagggcccggagggt
gtctccccaagccaggcacacctgcacaaacccagagccgaccctcagctgccttctagg
acacctgtgcagggtcccagacccaggccccagagcagcccaggccatgaccccgccgag
cacgagtccccccgtgcagccaagaacgttcccaggcagaactccgctcccctgctccaa
actgcactcctagggaatggggaaaggccccttggggcgaaggaagcgccccccttgaca
ctctcgctggtgaagccaagcgggaggggagctgcgccctccctgacctcccaggctgcg
gctcaggtggccaaccaggccctgatccggggtgactggaaccggggcggtggggtgcgg
gtggccagcgcacaacaggtaagcccggcccagtctgcccccatcccctcatcctccttt
cccctttccccctgcttttccctcccttccccatgcttcccattgcccctccaatgtcca
gttcaaatctctcgaggacctcaaggcctcccctccactgcaccccctctgatggcccct
ttatgtgaccctcaactgtacacaggtccctccccggcttcctccgggggcccggcccgg
ccggaggatgttcagcacctctgccttgcagggtgcccaggggggtgccagggctttgct
tggaggctactcccaagcctacgggactgtctgccactctgcactgggccacctgcccct
gctggaggggcaccatgtgtgagccgccctactcccttcacctggccctctgttcctgcc
ccagccccttccccagatccctctccagtctcctgcaccccttag

DBGET integrated database retrieval system