KEGG   Pan troglodytes (chimpanzee): 746712Help
Entry
746712            CDS       T01005                                 

Gene name
MAPK15
Definition
mitogen-activated protein kinase 15
Orthology
K08293  
mitogen-activated protein kinase [EC:2.7.11.24]
Organism
ptr  Pan troglodytes (chimpanzee)
Brite
Enzymes [BR:ptr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     746712 (MAPK15)
Protein kinases [BR:ptr01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   746712 (MAPK15)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
8
AA seq 306 aa AA seqDB search
MCTAVDPRIVRRYLLRRQLGQGAYGIVWKAVDRRTGEVVAIKKIFDAFRDKTDAQRTFRE
ITLLQEFGDHPNIISLLDVVRAENDRDIYLVFEFMGEYTLGVDMWSLGCILGEMLRGRPL
FPGTSTLHQLEVILETIPPPSEEDLLALGSGCRASVLHHLGSRPRQTLDALLPPDTSPEA
LDLLRRLLVFAPDKRLSATQALQHPYVQRFHCPSDEWAREADVRPRAHEGVQLSVPEYRS
RVYQMILECGGSSGTSREKGPEGVSPSQAHLHKPRADPQLPSRTPVQGPRPRVPEQPSHD
PAEHGV
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgtgcaccgcagtggaccctcgcattgtccggagatacctactcaggcggcagctcggg
cagggggcctatggcattgtgtggaaggcagtggaccggaggactggtgaggtcgtggcc
atcaagaaaatctttgatgcttttagggataagacagatgcccagagaacattccgggaa
atcacgctcctccaggagtttggggaccatcccaacatcatcagcctccttgacgtggtc
cgggcagagaacgacagggacatttacctggtgtttgagtttatgggtgaatacaccctt
ggggtggacatgtggagtctgggctgtatccttggggagatgctgcgggggagacccctg
ttcccgggcacgtccaccctccaccagctggaggtgatcctggagaccatcccaccgcca
tctgaggaggacctcctggctctcggctcaggctgccgtgcctctgtgctgcaccacctg
gggtcccggccacgacagacgctggatgccctcctaccgccagacacctccccagaggcc
ttggacctccttaggcgactcctggtgttcgccccggacaagcggttaagtgcgacccag
gcactgcagcacccctacgtgcagaggttccactgccccagcgacgagtgggcacgagag
gcagatgtgcggccccgggcacacgaaggggtccagctctctgtgcctgagtaccgcagc
cgcgtctatcagatgatcctggagtgtggaggcagcagcggcacctcgagagagaagggc
ccggagggtgtctccccaagccaggcacacctgcacaaacccagagccgaccctcagctg
ccttctaggacacctgtgcagggtcccagacccagggtcccagagcagcccagccatgac
cccgccgagcacggtgtgtga

DBGET integrated database retrieval system