KEGG   Pan troglodytes (chimpanzee): 746715Help
Entry
746715            CDS       T01005                                 

Definition
dual specificity mitogen-activated protein kinase kinase 3-like
Orthology
K04432  
mitogen-activated protein kinase kinase 3 [EC:2.7.12.2]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
MAPK signaling pathway
Rap1 signaling pathway
Toll-like receptor signaling pathway
Fc epsilon RI signaling pathway
TNF signaling pathway
Inflammatory mediator regulation of TRP channels
GnRH signaling pathway
Amyotrophic lateral sclerosis (ALS)
Toxoplasmosis
Influenza A
Epstein-Barr virus infection
Class
Environmental Information Processing; Signal transduction; Rap1 signaling pathway [PATH:ptr04015]
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:ptr04010]
Environmental Information Processing; Signal transduction; TNF signaling pathway [PATH:ptr04668]
Organismal Systems; Immune system; Toll-like receptor signaling pathway [PATH:ptr04620]
Organismal Systems; Immune system; Fc epsilon RI signaling pathway [PATH:ptr04664]
Organismal Systems; Endocrine system; GnRH signaling pathway [PATH:ptr04912]
Organismal Systems; Sensory system; Inflammatory mediator regulation of TRP channels [PATH:ptr04750]
Human Diseases; Neurodegenerative diseases; Amyotrophic lateral sclerosis (ALS) [PATH:ptr05014]
Human Diseases; Infectious diseases; Influenza A [PATH:ptr05164]
Human Diseases; Infectious diseases; Epstein-Barr virus infection [PATH:ptr05169]
Human Diseases; Infectious diseases; Toxoplasmosis [PATH:ptr05145]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 142 aa AA seqDB search
MCDFGISGYLVDSVAKTMDAGCKPYMAPERINPELNQKGHNVKSDVWSLGITMIEMAILW
FPYESWGTLFQQLKQVVEEPSPQLPADRFSPEFVDFTAQCLRKNPAEHMSYLELMEHPFF
TLHKTKKTDIAAFVKEILGEDS
NT seq 429 nt NT seq  +upstreamnt  +downstreamnt
atgtgtgactttggcatcagtggctacttggtggactctgtggccaagacgatggatgcc
ggctgcaagccctacatggcccctgagaggatcaacccagagctgaaccagaagggccac
aatgtcaagtctgacgtctggagcctgggcatcaccatgattgagatggccatcctgtgg
ttcccttacgagtcctgggggaccctgttccagcagctgaagcaggtagtggaggagcca
tcaccccagctcccagccgaccgtttctcccccgagtttgtggacttcactgctcagtgc
ctgaggaagaaccccgcagagcatatgagctacctggagctgatggagcaccccttcttc
accttgcacaaaaccaagaagacggacattgctgccttcgtgaaggagatcctgggagaa
gattcatag

DBGET integrated database retrieval system