KEGG   Pan troglodytes (chimpanzee): 746715Help
Entry
746715            CDS       T01005                                 

Definition
dual specificity mitogen-activated protein kinase kinase 3-like
Orthology
K04432  
mitogen-activated protein kinase kinase 3 [EC:2.7.12.2]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
MAPK signaling pathway
Rap1 signaling pathway
Toll-like receptor signaling pathway
Fc epsilon RI signaling pathway
TNF signaling pathway
Inflammatory mediator regulation of TRP channels
GnRH signaling pathway
Amyotrophic lateral sclerosis (ALS)
Toxoplasmosis
Influenza A
Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    746715
   04010 MAPK signaling pathway
    746715
   04668 TNF signaling pathway
    746715
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    746715
   04664 Fc epsilon RI signaling pathway
    746715
  Endocrine system
   04912 GnRH signaling pathway
    746715
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    746715
 Human Diseases
  Neurodegenerative diseases
   05014 Amyotrophic lateral sclerosis (ALS)
    746715
  Infectious diseases
   05164 Influenza A
    746715
   05169 Epstein-Barr virus infection
    746715
   05145 Toxoplasmosis
    746715
Enzymes [BR:ptr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     746715
Protein kinases [BR:ptr01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   746715
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 142 aa AA seqDB search
MCDFGISGYLVDSVAKTMDAGCKPYMAPERINPELNQKGHNVKSDVWSLGITMIEMAILW
FPYESWGTLFQQLKQVVEEPSPQLPADRFSPEFVDFTAQCLRKNPAEHMSYLELMEHPFF
TLHKTKKTDIAAFVKEILGEDS
NT seq 429 nt NT seq  +upstreamnt  +downstreamnt
atgtgtgactttggcatcagtggctacttggtggactctgtggccaagacgatggatgcc
ggctgcaagccctacatggcccctgagaggatcaacccagagctgaaccagaagggccac
aatgtcaagtctgacgtctggagcctgggcatcaccatgattgagatggccatcctgtgg
ttcccttacgagtcctgggggaccctgttccagcagctgaagcaggtagtggaggagcca
tcaccccagctcccagccgaccgtttctcccccgagtttgtggacttcactgctcagtgc
ctgaggaagaaccccgcagagcatatgagctacctggagctgatggagcaccccttcttc
accttgcacaaaaccaagaagacggacattgctgccttcgtgaaggagatcctgggagaa
gattcatag

DBGET integrated database retrieval system