KEGG   Pan troglodytes (chimpanzee): 746715Help
Entry
746715            CDS       T01005                                 

Definition
(RefSeq) dual specificity mitogen-activated protein kinase kinase 3-like
Organism
ptr  Pan troglodytes (chimpanzee)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 142 aa AA seqDB search
MCDFGISGYLVDSVAKTMDAGCKPYMAPERINPELNQKGHNVKSDVWSLGITMIEMAILW
FPYESWGTLFQQLKQVVEEPSPQLPADRFSPEFVDFTAQCLRKNPAEHMSYLELMEHPFF
TLHKTKKTDIAAFVKEILGEDS
NT seq 429 nt NT seq  +upstreamnt  +downstreamnt
atgtgtgactttggcatcagtggctacttggtggactctgtggccaagacgatggatgcc
ggctgcaagccctacatggcccctgagaggatcaacccagagctgaaccagaagggccac
aatgtcaagtctgacgtctggagcctgggcatcaccatgattgagatggccatcctgtgg
ttcccttacgagtcctgggggaccctgttccagcagctgaagcaggtagtggaggagcca
tcaccccagctcccagccgaccgtttctcccccgagtttgtggacttcactgctcagtgc
ctgaggaagaaccccgcagagcatatgagctacctggagctgatggagcaccccttcttc
accttgcacaaaaccaagaagacggacattgctgccttcgtgaaggagatcctgggagaa
gattcatag

DBGET integrated database retrieval system