KEGG   Pan troglodytes (chimpanzee): 747009Help
Entry
747009            CDS       T01005                                 

Definition
(RefSeq) liver carboxylesterase 1 isoform X1
  KO
K01044  carboxylesterase 1 [EC:3.1.1.1]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr00983  Drug metabolism - other enzymes
ptr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    747009
Enzymes [BR:ptr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     747009
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: COesterase Abhydrolase_3
Motif
Other DBs
NCBI-GeneID: 747009
NCBI-ProteinID: XP_024205613
Ensembl: ENSPTRG00000022723
Position
16
AA seq 567 aa AA seqDB search
MWLRALVLGTVAASTAWAGHPSSPPVVDTVHGKVLGKFVSLEGFAQPVAVFLGIPFAKPP
LGPLRFTPPQPAEPWSFVKNATSYPPMCTQDPKAGQFLSELLTNRKENIPLKLSEDCLYL
NIYTPADLTKKNRLPVMVWIYGGGLMVGAASTYDGRVLAAHENVVVVTIQHRLGIWGFFS
TGDEHSRGNWGHLDQLAALHWVQDNIASFGGNPGSVTIFGESSGAESVSVLIFSPLSKNL
FHRAISESGVALTPALVNEGDIKPLAEQIANTAGCETTNSAVMVHCLRQKTEEELLETTL
KMNFLTLDLHGDPRENYPHTPTVIDGVVLPKTPEELQAERKFHTVPYIVGFNRKEFGWLL
PTLMSYPLSEGKLDQKTAKSLLWKSYPFVRIPKELIPEAIEEYLGGTDDPVKKKDLFLDL
MGDVLFGVPSVTVARNHRDAGAPTYMYEFQYRPSFSSDMKPKTVIGDHGDELFSVFGAPF
LKEGASEEEIRLSKMVMKFWANFARTGNPNGEGLPHWPEYNQEEGYLQIGANTQAAQKLK
DKEVAFWTKLLAKKAVEKPPQIEHIAL
NT seq 1704 nt NT seq  +upstreamnt  +downstreamnt
atgtggctccgtgctcttgtcctgggcactgtcgccgcatccacggcttgggcagggcat
ccgtcctcgccacctgtggtggacaccgtgcatggcaaagtgctggggaagttcgtcagc
ttagaaggatttgcacagcctgtggctgttttcctgggaatcccttttgccaagccccct
cttggacccctgaggtttactccaccgcagcctgcagaaccgtggagctttgtgaagaat
gccacctcgtaccctcctatgtgcacccaagatcccaaggcagggcagtttctctcagag
ctattgactaacagaaaggagaacattcctctcaagctttctgaagactgtctttacctc
aatatttacactcctgctgacttgaccaagaaaaacaggctgccggtgatggtgtggatc
tatggaggggggctgatggtgggcgcagcatcaacctatgatgggcgggtcctcgctgcc
catgaaaacgtggtggtggtgaccattcagcaccgcctgggcatctggggattcttcagc
acaggggatgaacacagccgggggaactggggtcacctggaccagctggctgccctgcac
tgggtccaggacaacattgccagcttcggaggaaacccaggctctgtgaccatctttgga
gagtcatcgggagcagaaagtgtctctgttcttattttctctccattgtccaagaatctc
ttccaccgggccatttctgagagtggtgtggccctcactcctgctctggtgaacgagggt
gacatcaagcccctggctgagcaaattgctaacactgctgggtgtgaaaccaccaactca
gctgtgatggttcactgcctgcgacagaagacggaagaggagctcttggagacgacattg
aaaatgaatttcttaactctggacttacatggagaccccagagagaattacccccacaca
cctacggtgattgatggagtggtgctgccaaaaacacccgaggagcttcaagctgaaagg
aagttccacactgtcccctacatcgtcggatttaacaggaaggagtttggctggttgctt
ccaacgttgatgagctatccactctccgaagggaaactggaccagaagacagccaagtca
ctcttgtggaagtcctatccctttgttcgcattcctaaggaattgattccagaagccatt
gaggagtacttaggaggaacagacgaccctgtcaaaaagaaagacctgttcctggactta
atgggggacgtgctgttcggtgtcccatctgtgactgtggcccggaaccacagagatgct
ggagcacccacctacatgtatgagtttcagtaccgtccaagcttctcatcagacatgaaa
cccaagacggtgataggagaccacggggatgagctcttctctgtctttggggccccattt
ttaaaagagggtgcctcagaagaggagatcagacttagcaagatggtgatgaaattctgg
gccaactttgctcgcactggaaaccccaatggagaagggctgccgcactggccagagtac
aaccaggaggaagggtacctgcagattggtgctaacacccaggcagcccagaagctgaag
gacaaggaagtagctttctggaccaaactcttggccaagaaggcagtggagaagccaccc
cagatagaacacattgcgctgtga

DBGET integrated database retrieval system