KEGG   Pan troglodytes (chimpanzee): 747009Help
Entry
747009            CDS       T01005                                 

Gene name
CES1
Definition
(RefSeq) putative inactive carboxylesterase 4
  KO
K01044  
carboxylesterase 1 [EC:3.1.1.1]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
Drug metabolism - other enzymes
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    747009 (CES1)
Enzymes [BR:ptr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     747009 (CES1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
16
AA seq 433 aa AA seqDB search
MWLRALVLGTVAASTAWAGHPSSPPVVDTVHGKVLGKFVSLEGFAQPVAVFLGIPFAKPP
LGPLRFTPPQPAEPWSFVKNATSYPPMCTQDPKAGQFLSELLTNRKENIPLKLSEDCLYL
NIYTPADLTKKNRLPVMVWIYGGGLMVGAASTYDGRVLAAHENVVVVTIQHRLGIWGFFS
TGDEHSRGNWGHLDQLAALHWVQDNIASFGGNPGSVTIFGESSGAESVSVLIFSPLSKNL
FHRAISESGVALTPALVNEGDIKPLAEQIANTAGCETTNSAVMVHCLRQKTEEELLETTL
KMNFLTLDLHGDPRENYPHTPTVIDGVVLPKTPEELQAERKFHTVPYIVGFNRKEFGWLL
PTVRRHRPLGGTHPPPSALPSLVPRVLPSPSTALSPGQLFPSAGVNISMETFSRRAQLSP
GYQGPGIPSPQTL
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgtggctccgtgctcttgtcctgggcactgtcgccgcatccacggcttgggcagggcat
ccgtcctcgccacctgtggtggacaccgtgcatggcaaagtgctggggaagttcgtcagc
ttagaaggatttgcacagcctgtggctgttttcctgggaatcccttttgccaagccccct
cttggacccctgaggtttactccaccgcagcctgcagaaccgtggagctttgtgaagaat
gccacctcgtaccctcctatgtgcacccaagatcccaaggcagggcagtttctctcagag
ctattgactaacagaaaggagaacattcctctcaagctttctgaagactgtctttacctc
aatatttacactcctgctgacttgaccaagaaaaacaggctgccggtgatggtgtggatc
tatggaggggggctgatggtgggcgcagcatcaacctatgatgggcgggtcctcgctgcc
catgaaaacgtggtggtggtgaccattcagcaccgcctgggcatctggggattcttcagc
acaggggatgaacacagccgggggaactggggtcacctggaccagctggctgccctgcac
tgggtccaggacaacattgccagcttcggaggaaacccaggctctgtgaccatctttgga
gagtcatcgggagcagaaagtgtctctgttcttattttctctccattgtccaagaatctc
ttccaccgggccatttctgagagtggtgtggccctcactcctgctctggtgaacgagggt
gacatcaagcccctggctgagcaaattgctaacactgctgggtgtgaaaccaccaactca
gctgtgatggttcactgcctgcgacagaagacggaagaggagctcttggagacgacattg
aaaatgaatttcttaactctggacttacatggagaccccagagagaattacccccacaca
cctacggtgattgatggagtggtgctgccaaaaacacccgaggagcttcaagctgaaagg
aagttccacactgtcccctacatcgtcggatttaacaggaaggagtttggctggttgctt
ccaacggtgagaaggcacaggcctcttggagggactcacccacccccgtcagccctccca
tctctggtcccaagagtgcttccctctccaagcaccgctctgagtcctgggcagctgttc
ccttcagcaggagttaacatttccatggaaaccttctccaggagggcacagttgtcaccg
ggatatcagggccctgggatcccctctccccagactctctga

DBGET integrated database retrieval system