KEGG   Pan troglodytes (chimpanzee): 747924Help
Entry
747924            CDS       T01005                                 

Gene name
JOSD2
Definition
(RefSeq) Josephin domain containing 2
  KO
K15235  
josephin [EC:3.4.19.12]
Organism
ptr  Pan troglodytes (chimpanzee)
Brite
Enzymes [BR:ptr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     747924 (JOSD2)
Peptidases [BR:ptr01002]
 Cysteine Peptidases
  Family C86
   747924 (JOSD2)
Ubiquitin system [BR:ptr04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   MJD
    747924 (JOSD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
19
AA seq 188 aa AA seqDB search
MSQAPGAQPSPPTVYHERQRLELCAVHALNNVLQQQLFSQEAADEICKRLAPDSRLNPHR
SLLGTGNYDVNVIMAALQGLGLAAVWWDRRRPLSQLALPQVLGLILNLPSPMSLGLLSLP
LHRRHWVALRQVDGVYYNLDSKLRAPEALGDEDGVRAFLAAALAQGLCEVLLVVTKEVEE
KGSWLRTD
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgtcccaggccccgggagcacagccgagcccacccaccgtgtaccacgaacggcagcgc
ctggagctgtgtgctgtccacgccctcaacaacgttctgcagcagcagctctttagccag
gaggctgccgatgagatctgcaagaggttggccccagactcccggctgaaccctcatcgc
agcctcctgggcaccggcaactatgatgtcaatgtgatcatggccgctctgcaggggctg
ggcctggccgccgtgtggtgggacaggaggaggcccctgtcccagctggccctgccccag
gtactggggctgatcctgaacctgccctcgcccatgtcgctggggctgctgtcactgccg
ctgcaccggcggcactgggtggccctgcgccaggtggacggtgtctactacaacctggac
tccaagctgcgggcgcccgaggccctgggggatgaggacggagtcagggccttcctggcg
gctgcgctggcccagggcctgtgcgaggtgctgctggtagtgaccaaggaggtggaggag
aagggcagctggctgcggacagactga

DBGET integrated database retrieval system