KEGG   Pan troglodytes (chimpanzee): 747924Help
Entry
747924            CDS       T01005                                 

Gene name
JOSD2
Definition
Josephin domain containing 2
Orthology
K15235  
josephin [EC:3.4.19.12]
Organism
ptr  Pan troglodytes (chimpanzee)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
19
AA seq 146 aa AA seqDB search
MSQAPGAQPSPPTVYHERQRLELCAVHALNNVLQQQLFSQEAADEICKRXPSPTPAPGAA
GLXXXXPLPMWMGLLSLPLHRRHWVALRQVDGVYYNLDSKLRAPEALGDEDGVRAFLAAA
LAQGLCEVLLVVTKEVEEKGSWLRTD
NT seq 441 nt NT seq  +upstreamnt  +downstreamnt
atgtcccaggccccgggagcacagccgagcccacccaccgtgtaccacgaacggcagcgc
ctggagctgtgtgctgtccacgccctcaacaacgttctgcagcagcagctctttagccag
gaggctgccgatgagatctgcaagaggtgaccgtcacccaccccagcccctggagcagca
gggctnnnnnnnnnnnngcccttgcccatgtggatggggctgctgtcactgccgctgcac
cggcggcactgggtggccctgcgccaggtggacggtgtctactacaacctggactccaag
ctgcgggcgcccgaggccctgggggatgaggacggagtcagggccttcctggcggctgcg
ctggcccagggcctgtgcgaggtgctgctggtagtgaccaaggaggtggaggagaagggc
agctggctgcggacagactga

DBGET integrated database retrieval system