KEGG   Pan troglodytes (chimpanzee): 748505Help
Entry
748505            CDS       T01005                                 

Definition
histone H2B type 1-B-like
Orthology
K11252  
histone H2B
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
Alcoholism
Viral carcinogenesis
Systemic lupus erythematosus
Class
Human Diseases; Cancers; Viral carcinogenesis [PATH:ptr05203]
Human Diseases; Immune diseases; Systemic lupus erythematosus [PATH:ptr05322]
Human Diseases; Substance dependence; Alcoholism [PATH:ptr05034]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
6
AA seq 126 aa AA seqDB search
MPEPSKSAPAPKKGSKKAITKAQKKDGKKRKRSRKESYSIYVYKVLKQVHPDTGISSKAM
GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT
KYTSSK
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaaccctctaagtctgctccagcccctaaaaagggctctaagaaggctatcact
aaggcgcagaagaaggatggtaagaagcgtaagcgcagccgcaaggagagctattctatc
tatgtgtacaaggttctgaagcaggtccaccccgacaccggcatctcatccaaggccatg
gggatcatgaattccttcgtcaacgacatcttcgagcgcatcgcgggcgaggcttctcgc
ctggctcactacaataagcgctcgaccatcacctccagggagattcagacggctgtgcgc
ctgctactgcctggggagctggctaagcatgctgtgtccgagggcactaaggcagttacc
aagtacactagctctaaataa

DBGET integrated database retrieval system