KEGG   Pan troglodytes (chimpanzee): 748542Help
Entry
748542            CDS       T01005                                 

Gene name
USP6
Definition
ubiquitin specific peptidase 6
Orthology
K11837  
ubiquitin carboxyl-terminal hydrolase 6/32 [EC:3.4.19.12]
Organism
ptr  Pan troglodytes (chimpanzee)
Brite
Enzymes [BR:ptr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     748542 (USP6)
Peptidases [BR:ptr01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   748542 (USP6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
17
AA seq 1406 aa AA seqDB search
MDMVENADSLQAQERKDILMKYDKGHRAGMPEDKGPEPVGIYSSVDRFGILHETELPPVT
AREAKKIRREMTRTSKWMEMLGEWETYKHSSKLIDRVYKGIPMNIRGPMWSVLLNIQEIK
LKNPGRYQIMKERGKRSSEHIHHIDLDVRRTLRNHVFFRDRYGAKQRELFYILLAYSEYN
PEVGYCRDLSHIAALFLLYLPEEDAFWTLVQLLASERHSLPGFHSPNGGTVQGLQDQQEH
VVPKSQPKTMWHQDKEGLCGQCASLGCLLRNLIDGISLGLTLRLWDVYLVEGEQVLMPIT
SIALKVQQKRLMKTSRCGLWARLQNQFFDTWAMNDDTVLKHLRASTKKLTRKQGDLPPPA
KPEQGSLAPRPVPASHGGKTLCKGYRQAPSGPPAQFQRPICSASPPWAPRFSTPCPGGAV
REDTYPMGTQGVPSLSLAQGGPQGSWRFVEWKSMPQLPTDLDIGGPWFPHYDFEWSCWIR
AISQEDQLATCWQAEHCGEVHNKDMSWPEEMSFTANSSKIDRQKVPTEKGATGLSNLGNT
CFMNSSIQCVSNTQPLTQYFISGRHLYELNRTNPIGMKGHMAKCYGDLVQELWSGTQKSV
APLKLRRTIAKYAPRFDGFQQQDSQELLAFLLDGLHEDLNRVHEKPYVELKDSDGRPDWE
VAAEAWDNHLRRNRSIIVDLFHGQLRSQVKCKTCGHISVRFDPFNFLSLPLPMDSYMDLE
ITVIKLDGITPVRYGLRLNMDEEYTGLKKQLRDLCGLNSEQILLAEVHDSNIKNFPQDNQ
KVQLSVSGFLCAFEIPVPASPISASSPTQIDFSSSPSTNGMFTLTTNGDLPKPIFIPNGM
PNTVVPCGTEKNFTNGMVNGHMPSLPDSPFTGYIIAVHRKMMRTELYFLSPQENRPSLFG
MPLIVPCTVHTRKKDLYDAVWIQVSWLARPLPPQEASIHAQDRDNCMGYQYPFTLRVVQK
DGNSCAWCPQYRFCRGCKIDCGEDRAFIGNAYIAVDWHPTALHLRYQTSQERVVDKHESV
EQSRRAQAEPINLDSCLRAFTSEEELGESEMYYCSKCKTHCLATKKLDLWRLPPFLIIHL
KRFQFVNDXWIKSQKIVKFLQESFDPSAFLVPRDPALCQHKPLTPQGDELSKPRILAREV
KKVDAQSSAGKEDMLLSKSPSSLSANSSSSPKGSPSSSRKSGTSCPSSKNSSPNSSPRTL
GRSKGRLRLPQIGSKNKPSSSKKNLDASKENGAGQICELADALSRGHMRGGSQPELVTPQ
DHEVALANGFLYEHEACGNGCGDGYSNGQLGNHSEEDSTDDQREDTHIKPIYNLYAISCH
SGILSGGHYITYAKNPNCKWYCYNDSSCEELHPDEIDTDSAYILFYEQQGIDYAQFLPKI
DGKKMADTSSMDEDFESDYKKYCVLQ
NT seq 4221 nt NT seq  +upstreamnt  +downstreamnt
atggacatggtagagaacgcggatagtttgcaggcacaggagcggaaggacatacttatg
aagtatgacaagggacaccgagctggaatgccagaggacaaggggcctgagcccgttgga
atttacagcagcgttgatcgttttggcattctgcatgagacggagctgcctcctgtgact
gcacgggaggcgaagaaaattcggcgggagatgacacgaacgagcaagtggatggaaatg
ctgggagaatgggagacatataagcacagtagcaaactcatagatcgagtgtacaaggga
attcccatgaacatccggggcccgatgtggtcagtcctcctgaacattcaggaaatcaag
ttgaaaaaccccggaagataccagatcatgaaggagaggggcaagaggtcatctgaacac
atccaccacatcgacctggacgtgaggaggactctccggaaccatgtcttctttagggat
cgatatggagccaagcagagggaactattctacatcctcctggcctattcggagtataac
ccggaggtgggctactgcagggacctgagccacatcgccgccttgttcctcctttatctg
cctgaggaggacgcattctggacactggtgcagctgctggccagtgagaggcactccctg
ccaggattccacagcccaaatggtgggacagtccaggggctccaagaccaacaggagcat
gtggtacccaagtcacaacccaagaccatgtggcatcaggacaaggaaggtctatgcggg
cagtgtgcctcgttaggctgccttctccggaacctgattgacgggatctctctcgggctc
accctgcgcctgtgggacgtgtatttggtggaaggagaacaggtgttgatgccaataacc
agcattgctcttaaggttcagcagaagcgcctcatgaagacatccaggtgtggcctgtgg
gcacgtctgcagaaccaattcttcgatacctgggccatgaatgatgacaccgtgctcaag
catcttagggcctctacgaagaaactaacaaggaagcaaggggacctgccacccccagcc
aaacccgagcaagggtccttggcacccaggcctgtgccggcttcacatggtgggaagacc
ctctgcaaggggtataggcaggccccttcaggcccaccagcccagttccagcggcccatt
tgctcagcttcccccccatgggcacctcgtttttccacaccctgtcctggtggggctgtc
cgggaagacacgtaccctatgggcactcagggtgtgcccagcctgtccctggctcaggga
ggacctcagggttcctggagattcgtggagtggaagtcgatgccccagctcccaacggac
ctggatatagggggcccttggttcccccattatgattttgaatggagctgctggatccgt
gccatatcccaggaggaccagctggccacctgctggcaggctgaacactgcggagaggtt
cacaacaaagatatgagttggcctgaggagatgtcttttacagcaaatagtagtaaaata
gatagacaaaaggttcccacagaaaagggagccacaggtctaagcaacctgggaaacaca
tgcttcatgaactcaagcatccagtgcgttagtaacacacagccactgacacagtatttt
atctcagggagacatctttatgaactcaacaggacaaatcccattggtatgaaggggcat
atggctaaatgctatggtgatttagtgcaggaactctggagtggaactcagaagagtgtt
gccccattaaagcttcggcggaccatagcaaaatatgctcccaggtttgatgggtttcag
caacaagactcccaagaacttctggcttttctcttggatggtcttcatgaagatctcaac
cgagtccatgaaaagccatatgtggaactgaaggacagtgatgggcgaccagactgggaa
gtagctgcagaggcctgggacaaccatctaagaagaaatagatcaattattgtggatttg
ttccatgggcagctaagatctcaagtcaaatgcaagacatgtgggcatataagtgtccga
tttgaccctttcaattttttgtctttgccactaccaatggacagttacatggacttagaa
ataacagtgattaagttagatggtattacccctgtacggtatggactaagactgaatatg
gatgaagagtacacaggtttaaaaaaacagctgagggatctctgtggacttaattcagaa
caaatcctactagcagaagtacatgattccaacataaagaactttcctcaggataaccaa
aaagtacaactctcagtgagcggatttttgtgtgcatttgaaattcctgtccctgcgtct
ccaatttcagcttctagtccaacacagatagatttctcctcttcaccatctacaaatgga
atgttcaccctaactaccaatggggacctacccaaaccaatattcatccccaatggaatg
ccaaacacggttgtgccatgtggaactgagaagaacttcacaaatggaatggttaatggt
cacatgccatctcttcctgacagcccctttacaggttacatcattgcagtccaccgaaaa
atgatgaggacagaactgtatttcctgtcacctcaggagaatcgccccagcctctttgga
atgccattgattgttccatgcactgtgcatacccggaagaaagacctatatgatgcggtt
tggattcaagtatcctggttagcaagaccactcccacctcaggaagctagtattcatgcc
caggatcgtgataactgtatgggctatcaatatccattcactctacgagttgtgcagaaa
gatgggaactcctgtgcttggtgcccacagtatagattttgcagaggctgtaaaattgat
tgtggggaagacagagctttcattggaaatgcctatattgctgtggattggcaccccaca
gcccttcaccttcgctatcaaacatcccaggaaagggttgtagataagcatgagagtgtg
gagcagagtcggcgagcgcaagccgagcccatcaacctggacagctgtctccgtgctttc
accagtgaggaagagctaggggaaagtgagatgtactactgttccaagtgtaagacccac
tgcctagcaacaaagaagctggatctctggaggcttccacccttcctgattattcacctt
aagcgatttcaatttgtaaatgattagtggataaaatcccagaaaattgtcaaatttctt
caggaaagttttgatccgagtgcttttttggtaccacgagacccggccctctgccagcat
aaaccactcacaccccagggggatgagctctccaagcccaggattctggcaagagaggtg
aagaaagtggatgcgcagagttcggctggaaaagaggacatgctcctgagcaaaagccca
tcctcactcagcgctaacagcagcagcagcccaaaaggttctccttcttcatcaagaaaa
agtggaaccagctgtccctccagcaaaaacagcagccctaatagcagcccacggactttg
gggaggagcaaagggaggctccggctgccccagattggcagcaaaaataagccgtcaagt
agtaagaagaacttggatgccagcaaagagaatggggctgggcagatctgtgagctggct
gacgccttgagccgagggcatatgcgggggggcagccaaccagagctggtcactcctcag
gaccatgaggtagctttggccaatggattcctttatgagcatgaagcatgtggcaatggc
tgtggcgatggctacagcaatggtcagcttggaaaccacagtgaagaagacagcactgat
gaccaaagagaagacactcatattaagcctatttataatctatatgcaatttcatgccat
tcaggaattctgagtgggggccattacatcacttatgccaaaaacccaaactgcaagtgg
tactgttataatgacagcagctgtgaggaacttcaccctgatgaaattgataccgactct
gcctacattcttttctatgagcagcaggggatagactatgcacaatttctgccaaagatt
gatggcaaaaagatggcagacacaagcagtatggatgaagactttgagtctgattacaaa
aagtactgtgtgttacagtaa

DBGET integrated database retrieval system