KEGG   Pan troglodytes (chimpanzee): 748732Help
Entry
748732            CDS       T01005                                 

Gene name
HEXA, CELF6
Definition
hexosaminidase A (alpha polypeptide)
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Glycosaminoglycan degradation
Glycosphingolipid biosynthesis - globo series
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Lysosome
Module
Keratan sulfate degradation
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    748732 (HEXA)
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    748732 (HEXA)
   00603 Glycosphingolipid biosynthesis - globo series
    748732 (HEXA)
   00604 Glycosphingolipid biosynthesis - ganglio series
    748732 (HEXA)
   00511 Other glycan degradation
    748732 (HEXA)
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    748732 (HEXA)
Enzymes [BR:ptr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     748732 (HEXA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
15
AA seq 912 aa AA seqDB search
MTSSRLWFSLLLAAAFAGRATALWPWPQNIQTSDQRYVLYPNNFQFQYDVSSAAQPGCSV
LDEAFQRYRDLLFGSGSWPRPYLTGKRHTLEKNVLVVSVVTPGCNQLPTLESVENYTLTI
NDDQCLLLSETVWGALRGLETFSQLVWKSAEGTFFINKTEIEDFPRFPHRGLLLDTSRHY
LPLSSILDTLDVMAYNKLNVFHWHLVDDPSFPYESFTFPELMRKGSYNPVTHIYTAQDVK
EVIEYARLRGIRVLAEFDTPGHTLSWGPGIPGLLTPCYSGSEPSGTFGPVNPSLNNTYEF
MSTFFLEVSSVFPDFYLHLGGDEVDFTCWKSNPEIQDFMRKKGFGEDFKQLESFYIQTLL
DIVSSYGKGYVVWQEVFDNKVKIQPDTIIQVWREDIPVNYMKELELVTKAGFRALLSAPW
YLNRISYGPDWKDFYVVEPLAFEGTPEQKALVIGGEACMWGEYVDNTNLVPRLWPRAGAV
AERLWSNKLTSDLTFAYERLSHFRCELLRLQGRRTCLRLRDPAGLGRAGPHDAVRGVRPH
LRADXAEGPAHRPPQRLCLPHLLRPGLCSQGPECTARAEDPAREDRKLFVGMLGKQQGEE
DVRRLFQPFGHIEECTVLRSPDGTSKGCAFVKFGSQGEAQAAIQGLHGSRTMAGASSSLV
VKLADTDRERALRRMQQMAGHLGAFHPAPLPLGACGAYTTAILQHQGGLAGSRHKAQDLG
PVGAVAAQMQHVAAFSLVAAPLLPAAANSPPGSGPGTLPGLPAPIGVNGFGPLTPQTNGQ
PGSDTLYNNGLSPYPAAYPSAYAPVSTAFPQQPSALPQQQREGPEGCNLFIYHLPQEFGD
AELIQTFLPFGAVVSAKVFVDRATNQSKCFGFVSFDNPTSAQTAIQAMNGFQIGMKRLKV
QLKRPKDANRPY
NT seq 2739 nt NT seq  +upstreamnt  +downstreamnt
atgacaagctccaggctttggttttcgctgctgctggcggcagcgttcgcaggacgggcg
acggccctctggccctggcctcagaacatccaaacctccgaccagcgctacgtcctttac
ccgaacaactttcaattccagtacgatgtcagctcggccgcgcagcccggctgctcagtc
ctcgacgaggccttccagcgctatcgtgacctgcttttcggttccgggtcttggccccgt
ccttacctcacagggaaacggcatacactggagaagaatgtgttggttgtctctgtagtc
acacctggatgtaaccagcttcctactttggagtcagtggagaattataccctgaccata
aatgatgaccagtgtttactcctctctgagactgtctggggagctctccgaggtctggag
acttttagccagcttgtttggaaatctgctgagggcacattctttatcaacaagactgag
attgaggactttccccgctttcctcaccggggcttgctgttggatacatctcgccattac
ctgccactctctagcatcctggacactctggatgtcatggcgtacaataaattgaacgtg
ttccactggcatctggtagatgatccttccttcccatatgagagcttcacttttccagag
ctcatgagaaaggggtcctacaaccctgtcacccacatctacacagcacaggatgtgaag
gaggtcattgaatacgcacggctccggggtatccgtgtgcttgcggagtttgacactcct
ggccacactttgtcctggggaccaggtatccctggattactgactccttgctactctggg
tctgagccctctggtacctttggaccagtgaatcccagtctcaacaatacctatgagttc
atgagcacattcttcttagaagtcagctctgtcttcccagatttttatcttcatcttgga
ggagatgaggttgatttcacctgctggaagtccaacccagagatccaggactttatgagg
aagaaaggcttcggtgaggacttcaagcagctggagtccttctacatccagacgctgctg
gacatcgtctcttcttatggcaagggctatgtggtgtggcaggaggtgtttgataataaa
gtaaagattcagccagacacaatcatacaggtgtggcgagaggatattccagtgaactat
atgaaggagctggaactggtcaccaaggccggcttccgggcccttctgtctgccccctgg
tacctgaaccgtatatcctatggccctgactggaaggatttctacgtagtggaacccctg
gcatttgaaggtacccctgagcagaaggctctggtgattggtggagaggcttgtatgtgg
ggagaatatgtggacaacacaaacctggtccccaggctctggcccagagcaggggctgtt
gccgaaaggctgtggagcaacaagttgacatctgacctgacatttgcctatgaacgtttg
tcacacttccgctgtgagttgctgaggctgcaagggagacgaacgtgtctgaggctcagg
gatcccgcggggcttggacgagcaggacctcatgacgctgttcgaggagttcggccgcat
ctacgagctgacgntgctgaaggaccggctcaccggcctccacaaaggctgtgccttcct
cacctactgcgcccgggactctgctctcaaggcccagagtgcactgcacgagcagaagac
cctgccagggaggaccgaaagctgtttgtggggatgctgggcaagcagcagggtgaggag
gacgtcagacgcctgttccagccctttggccacatcgaggagtgcacggtcctgcggagt
cctgacggcaccagtaaaggctgtgcctttgtgaagttcgggagtcaaggggaagctcag
gcggccatccagggtctgcacggcagccggaccatggcgggcgcctcgtccagcctcgtg
gtcaagctggcggacaccgaccgggagcgcgccctgcggcggatgcagcagatggccggc
cacctgggcgccttccaccccgcgccactgccgctaggggcctgcggcgcctacaccacg
gcgatcctgcagcaccaaggcggccttgctgggagccgacacaaggctcaagacctaggc
ccggtgggggcagtggcggcccagatgcaacacgtggcggcctttagcctggtagctgcg
cctctgttgcccgcggcagccaactccccgcctggcagcggccctggcaccctcccaggt
cttccggcgcccatcggggtcaatggattcggccctctgaccccccagaccaatggccag
ccgggctccgacacgctctacaataacgggctctccccttacccagcagcctatccgtcg
gcctatgccccagtgagcacagcttttccccagcagccttcagccctgccccagcagcag
agagaaggccctgaaggctgtaacctcttcatctatcacctgcctcaggagtttggtgat
gcggaactcatacagacattcctgccctttggagccgttgtctctgctaaagtctttgtg
gatcgagccaccaaccagagcaagtgttttgggtttgttagttttgacaatccaactagt
gcccagactgctattcaggcgatgaatggctttcaaattggcatgaagaggctcaaggtc
cagctaaagcggcccaaggatgccaaccggccttactga

DBGET integrated database retrieval system