KEGG   Pan troglodytes (chimpanzee): 748765Help
Entry
748765            CDS       T01005                                 

Definition
(RefSeq) low affinity immunoglobulin gamma Fc region receptor II-b isoform X1
  KO
K16824  low affinity immunoglobulin gamma Fc receptor II-c
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr04145  Phagosome
ptr04380  Osteoclast differentiation
ptr05140  Leishmaniasis
ptr05150  Staphylococcus aureus infection
ptr05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    748765
 Organismal Systems
  Development
   04380 Osteoclast differentiation
    748765
 Human Diseases
  Infectious diseases
   05150 Staphylococcus aureus infection
    748765
   05152 Tuberculosis
    748765
   05140 Leishmaniasis
    748765
Membrane trafficking [BR:ptr04131]
 Endocytosis
  Phagocytosis
   Fc receptors
    748765
CD molecules [BR:ptr04090]
 Proteins
  748765
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ig_2 Ig_3 ig Ig_4 I-set V-set Ig_5 C2-set_2 DUF3827 CD34_antigen C1-set ECSCR V-set_CD47 Adeno_E3_CR2
Motif
Other DBs
NCBI-GeneID: 748765
NCBI-ProteinID: XP_024205432
Position
1
AA seq 310 aa AA seqDB search
MGILSFLPVLATESDWADCKSPQPWGHMLLWTAVLFLAPVAGTPAAPPKAVLKLEPQWIN
VLQEDSVTLTCRGTHSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSL
SDPVHLTVLSEWLVLQTPHLEFQEGETIVLRCHSWKDKPLVKVTFFQNGKSKKFSRSDPN
FSIPQANHSHSGDYHCTGNIGYTLYSSKPVTITVQAPSSSPMGIIVAVVTGIAVAAIVAA
VVALIYCRKKRISALPGYPECREMGETLPKKPANPTNPDEADKVGAENTITYSLLMHPDA
LEEPDDQNRI
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgggaatcctgtcattcttacctgtccttgccactgagagtgactgggctgactgcaag
tccccccagccttggggccatatgcttctgtggacagctgtgctattcctggctcctgtt
gctgggacacctgcagctcccccaaaggctgtgctgaaactcgagccccagtggatcaac
gtgctccaggaggactctgtgactctgacatgccgggggactcacagccctgagagcgac
tccattcagtggttccacaatgggaatctcatccccacccacacgcagcccagctacagg
ttcaaggccaacaacaatgacagcggggagtacacgtgccagactggccagaccagcctc
agcgaccctgtgcatctgactgtgctttccgagtggctggtgctccagacccctcacctg
gagttccaggagggagaaaccatcgtgctgaggtgccacagctggaaggacaagcctctg
gtcaaggtcacattcttccagaatggaaaatccaagaaattttcccgttcggatcccaac
ttctccatcccacaagcaaaccacagtcacagtggtgattaccactgcacaggaaacata
ggctacacgctgtactcatccaagcctgtgaccatcactgtccaagcgcccagctcttca
ccgatggggatcattgtggctgtggtcactgggattgctgtagcggccattgttgctgct
gtagtggccttgatctattgcaggaaaaagcggatttcagctctcccaggataccctgag
tgcagggaaatgggagagaccctccccaagaaaccagccaatcccactaatcctgacgag
gctgacaaagttggggctgagaacacaatcacctattcacttctcatgcacccggatgct
ctggaagagcctgatgaccagaaccgtatttag

DBGET integrated database retrieval system