KEGG   Pan troglodytes (chimpanzee): 748765Help
Entry
748765            CDS       T01005                                 

Gene name
FCGR2C
Definition
Fc fragment of IgG, low affinity IIc, receptor for (CD32)
Orthology
K16824  
low affinity immunoglobulin gamma Fc region receptor II-c
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
Phagosome
Osteoclast differentiation
Leishmaniasis
Staphylococcus aureus infection
Tuberculosis
Class
Cellular Processes; Transport and catabolism; Phagosome [PATH:ptr04145]
Organismal Systems; Development; Osteoclast differentiation [PATH:ptr04380]
Human Diseases; Infectious diseases; Staphylococcus aureus infection [PATH:ptr05150]
Human Diseases; Infectious diseases; Tuberculosis [PATH:ptr05152]
Human Diseases; Infectious diseases; Leishmaniasis [PATH:ptr05140]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1
AA seq 284 aa AA seqDB search
PVAGTPAAPPKAVLKLEPQWINVLQEDSVTLTCRGTHSPESDSIQWFHNGNLIPTHTQPS
YRFKANNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIVLRCHSWKDKP
LVKVTFFQNGKSKKFSRSDPNFSIPQANHSHSGDYHCTGNIGYTLYSSKPVTITVQAPSS
SPMGIIVAVVTGIAVAAIVAAVVAFIYCRKKQISANSTDPVKAAQFEPPGRQMIAIRKRQ
LEEINNDYETADGGYMTLNPRAPTDDDKNIYLTLPPNDHVNSNN
NT seq 857 nt NT seq  +upstreamnt  +downstreamnt
ctcctgttgctgggacacctgcagctcccccaaaggctgtgctgaaactcgagccccagt
ggatcaacgtgctccaggaggactctgtgactctgacatgccgggggactcacagccctg
agagcgactccattcagtggttccacaatgggaatctcatccccacccacacgcagccca
gctacaggttcaaggccaacaacgacagcggggagtacacgtgccagactggccagacca
gcctcagcgaccctgtgcatctgactgtgctttctgagtggctggtgctccagacccctc
acctggagttccaggagggagaaaccatcgtgctgaggtgccacagctggaaggacaagc
ctctggtcaaggtcacattcttccagaatggaaaatccaagaaattttcccgttcagatc
ccaacttctccatcccacaagcaaaccacagtcacagtggtgattaccactgcacaggaa
acataggctacacgctgtactcatccaagcctgtgaccatcactgtccaagcgcccagct
cttcaccgatggggatcattgtggctgtggtcactgggattgctgtagcggccattgttg
ctgctgtagtggcctttatctattgcaggaaaaagcagatttcagccaattccactgatc
ctgtgaaggctgcccagtttgagccacctggacgtcaaatgattgccatcagaaagagac
aacttgaagaaatcaacaatgactatgaaacagctgacggtggctacatgactctgaacc
ccagggcacctactgacgatgataaaaacatctacctgactcttcctcccaacgaccatg
tcaacagtaataactaa

DBGET integrated database retrieval system