KEGG   Pan troglodytes (chimpanzee): 748765Help
Entry
748765            CDS       T01005                                 

Gene name
FCGR2C
Definition
(RefSeq) low affinity immunoglobulin gamma Fc region receptor II-b
  KO
K16824  
low affinity immunoglobulin gamma Fc receptor II-c
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
Phagosome
Osteoclast differentiation
Leishmaniasis
Staphylococcus aureus infection
Tuberculosis
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    748765 (FCGR2C)
 Organismal Systems
  Development
   04380 Osteoclast differentiation
    748765 (FCGR2C)
 Human Diseases
  Infectious diseases
   05150 Staphylococcus aureus infection
    748765 (FCGR2C)
   05152 Tuberculosis
    748765 (FCGR2C)
   05140 Leishmaniasis
    748765 (FCGR2C)
Membrane trafficking [BR:ptr04131]
 Endocytosis
  Phagocytosis
   Fc receptors
    748765 (FCGR2C)
Cellular antigens [BR:ptr04090]
 Proteins
  748765 (FCGR2C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
1
AA seq 334 aa AA seqDB search
MGILSFLPVLATESDWADCKSPQPWGHMLLWTAVLFLAPVAGTPAAPPKAVLKLEPQWIN
VLQEDSVTLTCRGTHSPESDSIQWFHNGNLIPTHTQPSYRFKANNDSGEYTCQTGQTSLS
DPVHLTVLSGQWRKAPGWTWEGQDGSAPPKAVLKLEPQWINVLQEDSVTLTCRGTHSPES
DSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSDQGHYSSNN
GRYSNPSDHSHNDPHRLRIPWTVMVTGLDEYSVLSISTGRPSSLAVLWLIFLLFPTANPT
NPDEADKVGAENTITYSLLMHPDALEEPDDQNRI
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgggaatcctgtcattcttacctgtccttgccactgagagtgactgggctgactgcaag
tccccccagccttggggccatatgcttctgtggacagctgtgctattcctggctcctgtt
gctgggacacctgcagctcccccaaaggctgtgctgaaactcgagccccagtggatcaac
gtgctccaggaggactctgtgactctgacatgccgggggactcacagccctgagagcgac
tccattcagtggttccacaatgggaatctcatccccacccacacgcagcccagctacagg
ttcaaggccaacaacgacagcggggagtacacgtgccagactggccagaccagcctcagc
gaccctgtgcatctgactgtgctttctggtcagtggaggaaggccccagggtggacctgg
gagggccaggacggatcagctcccccaaaggctgtgctgaaactcgagccccagtggatc
aacgtgctccaggaggactctgtgactctgacatgccgggggactcacagccctgagagc
gactccattcagtggttccacaatgggaatctcatccccacccacacgcagcccagctac
aggttcaaggccaacaacaatgacagcggggagtacacgtgccagactggccagaccagc
ctcagcgaccctgtgcatctgactgtgctttccgatcaaggccactacagcagcaacaat
ggccgctacagcaatcccagtgaccacagccacaatgatccccatcgactccgcatacct
tggacagtgatggtcacaggcttggatgagtacagcgtcctcagcatcagcacaggcagg
ccctcttctctagcagtgctctggctgatatttcttctttttcccacagccaatcccact
aatcctgacgaggctgacaaagttggggctgagaacacaatcacctattcacttctcatg
cacccggatgctctggaagagcctgatgaccagaaccgtatttag

DBGET integrated database retrieval system