KEGG   Pan troglodytes (chimpanzee): 748852Help
Entry
748852            CDS       T01005                                 

Definition
chymosin-like
Orthology
K01378  
chymosin [EC:3.4.23.4]
Organism
ptr  Pan troglodytes (chimpanzee)
Brite
Enzymes [BR:ptr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.23  Aspartic endopeptidases
    3.4.23.4  chymosin
     748852
Peptidases [BR:ptr01002]
 Aspartic Peptidases
  Family A1: pepsin family
   748852
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1
AA seq 334 aa AA seqDB search
MRGLMVFLAVFALSEVNAITRVPLHKGKSLRRALKECRLLEDFLRNHHYAVSRKHSSSGV
VASESLTNYLDCQYFGKIYIGTPPQKFTLVFDTGSPDLWVPSVYCNSDACXNHQRFDPSK
SSTXQNMGKSLSIQYGTGSMWGLLGYDTVTVSNIVDPHQTVGLSTQEPGDIFTYSEFDGI
LGLAYPSLASEXSVPVFDNMMQRHLLAQDLFSVYMSRNDQGSMLTLRAIDLSYYTGSLHW
IPMTXQEYWQFTVDRWFDIDCGRLSSVPTVVFEIHGKKYPLPPSAYTSQDQGFCTSGFQG
DYSSQQWILGDVFIREYYSVFDRANNLVGLAKAV
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgaggggccttatggtgttccttgcagtctttgctctctctgaggtcaatgccatcacc
agggttcctctgcacaaagggaagtcgctgaggagggcactgaaggagtgcaggctcctg
gaggacttcctgaggaatcaccattatgcagtcagcaggaagcactccagctctggggtg
gtggccagcgagtctctgaccaactacctggattgtcagtactttgggaagatctacatc
gggacccctccccagaagttcaccttggtgtttgatacaggctccccggatctctgggtg
ccctctgtctactgcaacagtgatgcctgttaaaaccaccaacgcttcgatccgtccaag
tcctccaccncacagaacatgggcaagtccctgtccatccagtacggcacaggcagcatg
tggggcttgctgggctatgacactgtcaccgtctccaacattgtggacccccaccagact
gtgggcctgagcacccaggaacctggcgacatcttcacctactccgagtttgatgggatc
ctggggctggcctatccctcccttgcctctgagtagtcagtgccagtgtttgacaacatg
atgcagaggcacctgctggcccaggacctgttctcagtctacatgagcaggaatgaccag
gggagcatgctcacgctgagggccattgatctgtcctactacacaggctccctgcactgg
atacccatgactnngcaagaatactggcagttcactgtggacaggtggtttgacatcgac
tgcgggcgcctgagcagcgtgcccacggttgtcttcgagatccacggcaagaagtacccc
ctgccaccctccgcctacaccagccaggaccagggcttctgcaccagtggtttccagggt
gactatagttcccagcagtggatcctcggggatgtcttcatccgggagtattacagtgtc
tttgacagggccaataaccttgtggggctggcgaaggctgtctga

DBGET integrated database retrieval system