KEGG   Pan troglodytes (chimpanzee): 749332Help
Entry
749332            CDS       T01005                                 

Gene name
LYPLA2
Definition
lysophospholipase II (EC:3.1.1.5)
Orthology
K06130  
lysophospholipase II [EC:3.1.1.5]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    749332 (LYPLA2)
Enzymes [BR:ptr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     749332 (LYPLA2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 231 aa AA seqDB search
MCGNTMSVPLLTDAATVSGAERETAAVIFLHGLGDTGHSWADALSTIRLPHVKYICPHAP
RIPVTLNMKMVMPSWFDLMGLSPDAPEDEAGIKKAAENIKALIEHEMKNGIPANRIVLGG
FSQGGALSLYTALTCPHPLAGIVALSCWLPLHRAFPQAANGSAKDLAILQCHGELDPMVP
VRFGALTAEKLRSVVTPARVQFKTYPGVMHSSCPQEMAAVKEFLEKLLPPV
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggtaacaccatgtctgtgcccctgctcaccgatgctgccactgtgtctggagct
gagcgggaaacggccgcggttatttttttacatggacttggagacacagggcacagctgg
gctgacgccctctccaccatccggctccctcacgtcaagtacatctgtccccatgcgcct
aggatccctgtgaccctcaacatgaagatggtgatgccctcctggtttgacctgatgggg
ctgagtccagatgccccagaggacgaggctggcatcaagaaggcagcagagaacatcaag
gccttgattgagcatgaaatgaagaacgggatccctgccaatcgaatcgtcctgggaggc
ttttcacagggcggggccctgtccctctacacggccctcacctgcccccaccctctggct
ggcatcgtggcgttgagctgctggctgcctctgcaccgggccttcccccaggcagctaat
ggcagtgccaaggacctggccatactccagtgccatggggagctggaccccatggtgccc
gtacggtttggggccctgacggctgagaagctccggtctgttgtcacacctgccagggtc
cagttcaagacatacccgggtgtcatgcacagctcctgtcctcaggagatggcagctgtg
aaggaatttcttgagaagctgctgcctcctgtctaa

DBGET integrated database retrieval system