KEGG   Pan troglodytes (chimpanzee): 749515Help
Entry
749515            CDS       T01005                                 

Definition
protein disulfide-isomerase A2-like
Orthology
K09581  
protein disulfide isomerase family A, member 2 [EC:5.3.4.1]
Organism
ptr  Pan troglodytes (chimpanzee)
Brite
Enzymes [BR:ptr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     749515
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
16
AA seq 215 aa AA seqDB search
MEQHACSLLGCQVWRGCSWGCGGLGHSRPHPPDAPWCGHCQALAPEYSKAAAVLAAESTV
VTLAKVDGPAQRELAEEFGVTEYPTLKFFRNGNRTHPEEYTGPRDAEGIAEWLRRRVGPS
ATRLEDEAAAQALIGGRDLVVIGFFQDLQDEDVAAFLALAQDALDMTFGLTDRPRLFQQF
GLSKDTVVLFKKVGQAQVRVGVRLPRPLTHLLLSS
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atggagcagcacgcttgttccctgctgggttgtcaggtgtggagagggtgctcctggggt
tgtggtggcctggggcactcacggccccatcccccagatgccccgtggtgtgggcactgc
caggccctggcccccgagtacagcaaggcagctgccgtgctcgcggccgagtcaacggtg
gtcacgctggccaaggtggacgggcccgcgcagcgcgagctggctgaggagtttggtgtg
acggagtaccctacgctcaagttcttccgcaacgggaaccgcacgcacccggaggagtac
acaggaccacgggacgctgagggcattgccgagtggctgcgacggcgggtggggcccagt
gccacgcggctggaggacgaggcggccgcccaggcgctgatcggtggccgggacctagtg
gtcatcggcttcttccaggacctgcaggacgaggacgtggccgccttcttggccctggcc
caggacgccctggacatgacctttggcctcacagaccggccgcggctctttcagcagttt
ggtctcagcaaggacactgtggttctcttcaagaaggtaggtcaggcccaggtgagggtt
ggggtccggctaccgcgcccgctgacccacctgctgctgtccagttga

DBGET integrated database retrieval system