KEGG   Pan troglodytes (chimpanzee): 749982Help
Entry
749982            CDS       T01005                                 

Gene name
GAMT
Definition
guanidinoacetate N-methyltransferase
Orthology
K00542  
guanidinoacetate N-methyltransferase [EC:2.1.1.2]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
Glycine, serine and threonine metabolism
Arginine and proline metabolism
Metabolic pathways
Module
Creatine pathway
Class
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:ptr00260]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:ptr00330]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
19
AA seq 217 aa AA seqDB search
MSAPSATPIFAPGENCSPAWGAAPAAYDAADTHLRILGKPVMERWETPYMHALAAAASSK
GGRVLEVGFGMAIAASKVQEAPIDEHWIIECNDGVFQRLQDWAPRQTHKVVPLKGLWEDV
APTLXXXXXXXXPQNHAFRLLKPGGVLTYCNLTSWGELMKSKYSDITIMFEETQVPALLE
AGFRRENIRTEVMALVPPADCRYYAFPQMITPLVTKG
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcccccagcgcgacccccatcttcgcgcccggcgagaactgcagccccgcgtgg
ggggcggcgcccgcggcctacgacgcagcggacacgcacctgcgcatcctgggcaagccg
gtgatggagcgctgggagaccccctatatgcacgcgctggccgccgccgcctcctccaaa
gggggccgggtcctggaggtgggctttggcatggccatcgcagcgtcaaaggtgcaggag
gcgcccattgatgagcattggatcatcgagtgcaatgacggcgtcttccagcggctccag
gactgggccccacggcagacacacaaggtcgtccccttgaaaggcctgtgggaagatgtg
gcacccaccctnnnnnnnnnnnnnnnnnnnnnnnnnccacagaaccacgcctttcgcctg
ctgaagccggggggcgtcctcacctactgcaacctcacctcctggggggagctgatgaag
tccaagtactcagacatcaccatcatgtttgaggagacgcaggtgcccgcgctgctggag
gccggcttccggagggagaacatccgtacggaggtgatggcgctggtcccaccggccgac
tgccgctactacgccttcccacagatgatcacgcccctggtgaccaaaggctga

DBGET integrated database retrieval system