KEGG   Pan troglodytes (chimpanzee): 750726Help
Entry
750726            CDS       T01005                                 

Gene name
USP17
Definition
ubiquitin specific peptidase 17
Orthology
K11845  
ubiquitin carboxyl-terminal hydrolase 17 [EC:3.1.2.15]
Organism
ptr  Pan troglodytes (chimpanzee)
Brite
Enzymes [BR:ptr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     750726 (USP17)
Peptidases [BR:ptr01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   750726 (USP17)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4
AA seq 354 aa AA seqDB search
MLSREHSQTCHRHKGCMLCTMQAHITRALHIPGHVIQPSQALAAGFHRGKQEDAHEFLMF
TVDAMEKACLPGHKQVEHHSKDTTLIHQIFGGYWRSQIKCLHCHGISDTFDPYLDIALDI
QAAQSVQQALEQLVKPEELNGENAYHCGLCLQRAPASKTLTLHTSAKVLILVLKRFSDVT
GNKLAKNVQYPECLDMQPYMSQQNTGPLVYVLYAVLVHAGWSCHNGHYFSYVKAQEGQWY
KMDDAEVTASSVTSVLSQQAYVLFYIQKSEWERHSESASRGREPRALGAEDTDRRATQGE
LKRDHPCLQAPELGEHLVERATQESTLDHWKFLQSKQTKPESRQKVEVTCLHVL
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgctgtcccgggagcactctcaaacgtgtcatcgtcacaagggctgcatgctctgtact
atgcaagctcacatcacacgggccctccacattcctggccatgtcatccagccctcacag
gcattggctgctggcttccatagaggcaagcaggaagatgcccatgaatttctcatgttc
actgtggatgctatggaaaaggcatgccttcccgggcacaagcaggtagagcatcactct
aaggacaccaccctcatccaccaaatatttggaggctactggagatctcaaatcaagtgt
ctccactgccacggcatttcagacacttttgacccttacctggacatcgccctggatatc
caggcagctcagagtgtccagcaagctttggaacagttggtgaagcccgaagaactcaat
ggagagaatgcctatcattgtggtctttgtctccagagggcgccggcctccaagacgtta
actttacacacttctgccaaggtcctcatccttgtattgaagagattctccgatgtcaca
ggcaacaaacttgccaagaatgtgcaatatcctgagtgccttgacatgcagccatacatg
tctcagcagaacacaggacctcttgtctatgtcctctatgctgtgctggtccacgctggg
tggagttgtcacaacggacattacttctcttatgtcaaagctcaagaaggccagtggtat
aaaatggatgatgccgaggtcaccgcctctagcgtcacttctgtcctgagtcaacaggcc
tatgtcctcttttacatccagaagagtgaatgggaaagacacagtgagagtgcgtcaaga
ggcagggaaccaagagcccttggcgctgaagacacagacaggcgagcaacgcaaggagag
ctcaagagagaccacccctgcctgcaggcacccgagttgggcgagcacttggtggaaaga
gccactcaggaaagcaccttagaccactggaaattccttcagagcaaacaaacgaagcct
gagtcacgtcagaaagtcgaagtaacctgcctccacgtactgtga

DBGET integrated database retrieval system