KEGG   Pan troglodytes (chimpanzee): 751063Help
Entry
751063            CDS       T01005                                 

Definition
(RefSeq) cAMP-dependent protein kinase catalytic subunit PRKX-like
  KO
K19584  
protein kinase X [EC:2.7.11.11]
Organism
ptr  Pan troglodytes (chimpanzee)
Brite
Enzymes [BR:ptr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     751063
Protein kinases [BR:ptr01001]
 Serine/threonine protein kinases: AGC group
  PRKX family
   751063
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
X
AA seq 344 aa AA seqDB search
MEAPGLAQAAAAESDSRKVAEETPDGAPALCPSPEALSPEPPAYSLQDFDTLATVGTGTF
GRVHLVKEKTAKHFFALKVMSIPDVIRLKQEQHVHNEKSVLKEVSHPFLIRLFWTWHDER
FLYMLMEYVPGGELFSYLRNRGRFSSTTGLFYSAEIICAIEYLHSKEIVYRDLKPENILL
DRDGHIKLTDFGFTKKLVHRNSYHYKAGIFFHAYSPLKIHVCFSNRFPPFFDDNPFGIYQ
KILAGKIDFPRHLDFHVKDLIKKLLVVDRTRRLGNMKNGANDVKRHRWFRSVDWEAVPQR
KLKPPIVPKIAGDGDTSNFETYPENDWDTAAPVPQKDLEIFKNF
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atggaggcgcccgggctggcccaggcggccgcggcggagagcgactcccgcaaggtggcg
gaggagacccccgacggggcgcccgcgctctgccccagccctgaggcgctgtcgccggag
ccgcctgcgtacagcctgcaggactttgacacgctggccaccgtgggcactgggacgttc
gggcgggtgcacctggtgaaggagaagacagccaagcatttcttcgccctcaaggtgatg
agcattcccgacgtcatccgcctgaagcaggagcagcacgtgcacaatgagaagtccgtc
ctgaaggaagtcagccacccgttcctcatcaggctgttctggacgtggcatgacgagcgc
ttcctctacatgctcatggagtacgtgccgggtggcgagctcttcagctacctgcgcaac
cgggggcgcttctccagcaccacggggctcttctactctgcggagatcatctgtgccatc
gagtacctgcactccaaggagatcgtctacagggatttgaagccggagaacatcctgctg
gatagggatggccacatcaagctcacggactttgggttcaccaagaagctggtacacaga
aatagctatcattacaaagcagggatttttttccatgcttactccccactaaaaatacat
gtttgtttttctaacaggtttcctccgttttttgatgacaacccgtttggcatttatcag
aaaattcttgcaggcaaaatagatttccccagacatttggatttccacgtaaaagacctc
attaagaaactgctcgtggttgacagaacaaggcgattaggaaacatgaagaacggggcg
aatgatgtgaaacgtcatcggtggttccgctccgtggactgggaagctgttccgcagaga
aaactgaagcctcccatcgtgcccaagatagctggcgacggcgacacttccaacttcgaa
acttaccctgagaatgactgggacacagccgcgcccgtgccgcagaaggatttagaaatc
ttcaagaatttctga

DBGET integrated database retrieval system