KEGG   Candidatus Pelagibacter ubique: SAR11_0028Help
Entry
SAR11_0028        CDS       T00257                                 

Gene name
murEF
Definition
bifunctional UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase/UDP-N-acetylmuramoyl-tripeptide:D-alanyl-D-alanine ligase (EC:6.3.2.13)
Orthology
K15792  
murE/murF fusion protein [EC:6.3.2.13 6.3.2.10]
Organism
pub  Candidatus Pelagibacter ubique
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pub00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    SAR11_0028 (murEF)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SAR11_0028 (murEF)
Enzymes [BR:pub01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.10  UDP-N-acetylmuramoyl-tripeptide---D-alanyl-D-alanine ligase
     SAR11_0028 (murEF)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     SAR11_0028 (murEF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(30981..33827)
Genome map
AA seq 948 aa AA seqDB search
MLIGNFLKNIKKEFKNHQFAGLSFNSEDCKKNYIFFAIQGTKSDGTKFIDHAIKKGATVI
ISEQKFEGIKNKVLFLRSKNVRKILSELSYKTKKNIPKNLIAVTGTNGKSSIADFYFQLL
NLGNKKVASIGTLGVKTKNSLKKVSNTTLDPIKLSKILNDLKKQKIDNVIMEASSHGLKQ
NRLDGLKFNTTIFTNLSHDHLDYHKTFNDYLKSKLYLFEKLLKPRGTIITDSKIPEYKNL
KRISLNNKLDLQALSKSNNGIDIYSHQFRDDKQIVEIKYNQKHYKLKINLIGKIQLKNLF
MAMLAAKKSNLKFDQIVKLASRVKSVIGRFEKIGTLKNNSKVILDYAHTPDALKTCLTNL
KEQFENKRIFIVFGCGGNRDKDKRPIMGKIANQYCDRVYLTDDNPRDENPKKIRLAIKKT
IDKSKVFEISSRSKAIHKAILDLKTGDILVIAGKGHEQTQDYGNFVNKFSDRLEILKNIK
LKNKILSTNIKINILKEISNSPQINSNIKIKNASINSKTIKKNDIFFAIKGNNKDGNLYV
NEAFQNGASLVIANNQKKSKKKIVVDDTLQLLTEASSKLRENLSSKIISITGSCGKTSLK
ELLGKTLSKISNVTYSPKSFNNKFGVPLSLFNLKKNDEFGIFEIGMDKKGEIDYLSKIIK
PDVGVITNISYAHIKNFKNIHQVALAKSEIINNIKTNGILVLNQDDRFYNLHKKIAKKKN
INIFTFSLKNKSANIYLEKIVKERSKYKIFVNVNKKQIYFYVRLIFENNLKNLLATIAII
SIFKDTQKLEKNIFLDYEMTKGRGDIIKVKLKKKSIYIVDESYNSNPLSLKSAIKNFDEL
KIDNSKKKLILSDMLELGNYSKKLHLEAGKEINKTSLKNINVVGKHILHTYKNLDKHRRG
VILKDKSKIIDLIKNDLNNNDYLMIKGSNSTGLNNLVNKLKTGKFNAL
NT seq 2847 nt NT seq  +upstreamnt  +downstreamnt
atgttgattggcaacttccttaaaaatattaaaaaagaatttaaaaatcatcagtttgct
ggtcttagttttaacagtgaagattgtaaaaagaattatattttttttgcaatccaggga
acaaaatcagatggaactaaattcatagaccatgcaattaaaaagggtgcaacagttatt
atttcagagcaaaaatttgaaggtattaaaaataaagtgttatttttaagatcaaaaaat
gtaagaaaaatattatcagaattatcatataagacaaaaaaaaatatacctaaaaattta
attgctgtaacaggaacaaatggaaagtcatcaattgcagatttttattttcagctactc
aacttaggtaataaaaaagtagcttctattggaacattaggagttaagacaaaaaatagt
ttaaagaaagtttctaatacaacattagatccaattaaattaagcaaaatattaaatgat
ttaaaaaaacaaaaaattgacaatgttataatggaagcttctagtcatggtcttaagcaa
aatagacttgatggtttaaaatttaatactacaatttttacaaatttgtctcatgatcat
ttagattatcacaaaacatttaatgattatctcaaatcaaagttatatctttttgagaag
ctattaaaacctagaggaactatcatcaccgatagtaaaattcccgaatataaaaattta
aaaagaatatcgctaaataataaattggatcttcaggctttatcaaaaagtaataatgga
atagatatttattctcatcaatttagggatgataaacaaatagtcgaaattaaatataat
cagaaacattataaattaaaaataaacttaattggtaaaattcaattaaaaaacttattt
atggcaatgcttgctgctaaaaaaagtaatttaaaatttgatcaaatagtaaaattagct
tcaagagtaaaatcagtaattggtaggtttgaaaaaattggaactttaaaaaataattca
aaggttattttagattatgctcatacacctgatgcattaaaaacttgtttgactaatttg
aaagaacaatttgaaaataaaagaattttcattgtatttggatgtggtggtaatagagat
aaagacaagagacccataatgggaaaaatagccaatcaatattgtgacagagtttattta
actgacgacaatccaagagacgaaaatccaaaaaaaataagactagctattaaaaaaact
attgataaatcaaaagtttttgagatttcaagcaggtctaaagctattcataaggctata
ttagacttaaaaactggtgatatcttagttattgcaggcaaaggtcatgaacagacacaa
gattatggaaattttgtaaacaaattttctgacagattagaaatacttaagaatattaaa
ttaaaaaataaaattctttcaactaatattaaaataaatattttaaaagaaatcagcaac
tctccccaaattaattcaaatataaaaataaaaaatgcatcaattaattcaaaaacaata
aaaaaaaatgacatattttttgcaataaaaggaaataataaagatggaaatctatatgtt
aatgaagctttccaaaatggtgcatcattagtaatagctaacaatcaaaaaaaatctaaa
aaaaaaattgtagtagatgatacattgcaacttttaacagaggcttcatcaaaattaaga
gaaaatttatctagtaaaattatatctataacaggcagttgtggaaaaacttctcttaaa
gaattattaggaaaaactttaagtaagattagtaatgtaacttattcaccaaaatctttt
aataataaatttggtgtaccattaagtttatttaatctaaaaaaaaatgatgaatttggt
atttttgagattggaatggataaaaaaggtgagattgattatctatcaaaaattatcaag
cctgatgtgggtgttattacaaatatttcctacgcacatattaaaaattttaaaaacatt
catcaagtagctttagcaaagtcagaaattattaataatataaaaacaaatggaattctt
gttttaaaccaagatgacagattttataatttacataaaaaaattgccaagaaaaaaaac
ataaatatttttacatttagtttaaaaaataaatcagcaaatatttatctagaaaaaata
gttaaagaaagatctaaatacaaaatatttgtaaatgttaataaaaaacaaatttatttt
tatgtaagattaatttttgaaaataatttaaaaaacttattagccacaattgcaattata
tcaatttttaaagatacacaaaaattagaaaaaaatatatttcttgattatgagatgaca
aaaggccgtggtgatattataaaggttaaattaaaaaaaaagagtatttacattgtagat
gagagttataactctaatccattatcattaaagtctgctataaaaaattttgatgaatta
aaaattgataattctaaaaaaaaattaatactgagtgacatgttggagttaggaaattat
tcaaagaaactacacttagaggctggcaaagaaattaataaaacttctcttaaaaatatt
aatgtagtgggtaaacatattttacatacttataaaaaccttgataagcaccgaagaggg
gtcattttgaaagataagtctaaaataattgatttgattaaaaatgatttaaataataat
gattatttaatgattaagggctcaaactctactggacttaacaatctagttaacaaatta
aaaactggaaagtttaatgctttatag

DBGET integrated database retrieval system