KEGG   Candidatus Pelagibacter ubique: SAR11_0223Help
Entry
SAR11_0223        CDS       T00257                                 

Gene name
proB
Definition
(GenBank) Glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
pub  Candidatus Pelagibacter ubique
Pathway
pub00330  Arginine and proline metabolism
pub00332  Carbapenem biosynthesis
pub01100  Metabolic pathways
pub01130  Biosynthesis of antibiotics
pub01230  Biosynthesis of amino acids
Module
pub_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:pub00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    SAR11_0223 (proB)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    SAR11_0223 (proB)
Enzymes [BR:pub01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     SAR11_0223 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA Nitro_FeMo-Co
Motif
Other DBs
NCBI-ProteinID: AAZ21044
UniProt: Q4FP45
Position
222512..223618
Genome map
AA seq 368 aa AA seqDB search
MYLKDSKIIVIKIGSSLLIDDKKKVRRKWLTEFAKDIQELIKQNKKVIIVSSGAIAMGCK
KLNISKKNLKIDKSQAVASIGQIELMNLFSETFVKLKINISQILLTLEDTEQRRRALNAK
RTFDNLFKLGFVPIVNENDTIATSEIKYGDNDRLASRVAQISGADSLILLSDVDGLYTHN
PKIYKNAKLIKEIRNIDKDIEKIATKSISEHGTGGMKTKIDAAKICQLSGCQMVIANGLV
NRPIKKITEENKCTWFLPKVSKLDARKKWIISSVSPKGALIIDDGAKQALSNGKSLLAAG
IKKVSGRFSKGDHIKVLDKNNYECARGLSSFSSNEIEKIMGHHSKEIEKLLGYISKSEVI
HKDDIVEV
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgtatcttaaagattctaaaataattgtaattaagattggttcatccttgttaatagac
gacaaaaaaaaagtaaggagaaaatggcttactgaatttgctaaagatattcaggaatta
ataaaacagaataaaaaggttattattgtaagctctggagcaatagcaatgggttgcaaa
aaactaaatattagcaaaaaaaaccttaagattgataaaagtcaggctgttgcttctatt
gggcaaattgaactaatgaacttattttcagaaacatttgttaaattaaaaattaatatt
tctcaaattcttctcactctagaagatacagaacaaagaagaagagcccttaacgcaaaa
agaacttttgataatttatttaaactgggctttgtaccaatagtaaatgaaaatgatact
atcgctacttcagagattaagtatggtgataatgacagattagcatctcgtgttgcacaa
atatcaggtgcagactcccttattttgctttctgatgtagatggtctttatacacataat
ccaaaaatatataaaaatgcaaaattaataaaagaaataagaaatatagataaagatata
gaaaaaatagcgaccaaaagtattagtgagcatggaacgggtggcatgaaaactaaaata
gatgctgctaaaatctgtcaattatcaggatgccaaatggtaatagcaaatggcttggtt
aaccgacctattaaaaaaataactgaagagaataaatgtacatggtttttacctaaggtt
tcaaaattagatgctagaaaaaaatggattatcagctctgtttcacctaaaggtgccctg
attattgatgatggtgcgaaacaagcactttcaaatggtaaaagtttattagcagcagga
ataaaaaaagtatctgggcgatttagtaaaggagatcatattaaagttttagataaaaat
aattatgaatgtgcaagaggacttagctctttttcatctaatgaaatagaaaaaataatg
ggtcaccactcaaaagaaatagaaaaattactaggatatatttccaaatcagaagtaatt
cataaagatgatatagtagaggtatag

DBGET integrated database retrieval system