KEGG   Candidatus Pelagibacter ubique: SAR11_0236Help
Entry
SAR11_0236        CDS       T00257                                 

Gene name
sucB
Definition
(GenBank) 2-oxoglutarate dehydrogenase complex E2 component
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
pub  Candidatus Pelagibacter ubique
Pathway
pub00020  Citrate cycle (TCA cycle)
pub00310  Lysine degradation
pub01100  Metabolic pathways
pub01110  Biosynthesis of secondary metabolites
pub01120  Microbial metabolism in diverse environments
pub01130  Biosynthesis of antibiotics
pub01200  Carbon metabolism
Module
pub_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pub00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SAR11_0236 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    SAR11_0236 (sucB)
Enzymes [BR:pub01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     SAR11_0236 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H
Motif
Other DBs
NCBI-ProteinID: AAZ21057
UniProt: Q4FP32
Position
complement(235642..236919)
Genome map
AA seq 425 aa AA seqDB search
MSEKILVPVLGESITEATVAKWLKKEGDTVVADEAIVELETDKVNLEVPSPIDGVLSEIN
SKDGETVEVGALLGMISQNGAQPSEKKIITKIEPKKTENNVVNLEIKKEAPKVLKEPEEE
EPLVLTNEVKEEKTNSSNNNNEILSPAVRKIVVENKIDLKKVSGSGKEGRVLKGDLISMM
GENPQPSERKIKYGQEERIKMSRLRQTIAKRLKQAQENAALLTTFNEVDMTGIMEMRKEN
QEDFQSRYGIKLGFMSFFVKACVAALKMYPSVNAEIDGDEIIYKNYYNMSFAVGTEKGLV
VPVLRDADQLSFADIEKNIKTISEKARDGKITIEDLQGGTFTISNGGVYGSMLSTPILNL
PQSGVLGMHNIVERPMVVDGEIKIRPIMYLALSYDHRIIDGKESVSFLKMVKENLEDPRR
LFLNI
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaaaaaattttagtaccagttcttggagaaagcattactgaagcgacagttgct
aagtggcttaagaaagaaggcgatacagtggtagctgatgaggcaattgtagaattagaa
actgataaagttaatttagaagtaccatctccaattgatggggttttgtccgaaataaat
tctaaagatggagaaacagttgaagtaggtgctcttcttggtatgataagtcaaaatgga
gctcaaccatctgaaaaaaagataattacaaaaattgaacctaagaaaacagaaaataat
gtagttaatttagaaattaaaaaagaagctcctaaagttcttaaagaacctgaagaggaa
gagccattggtattaaccaatgaggttaaagaggagaaaactaattcttcaaataataat
aatgaaatactttcaccagcagtaagaaaaattgtagttgaaaataaaattgatttaaaa
aaagttagtggctctggtaaagagggtagagttcttaaaggtgacctaattagtatgatg
ggagagaaccctcaaccatcagaaagaaaaattaaatacggtcaagaagagagaattaaa
atgtctaggcttagacaaacaattgcaaaaagattaaaacaagcacaagaaaatgcagca
ttattaacaactttcaatgaagttgatatgactggcataatggaaatgagaaaagagaac
caggaagatttccaaagcagatacggaattaaattagggttcatgtcattttttgtaaaa
gcatgtgttgctgcactaaaaatgtatccatctgttaatgctgaaattgatggagatgaa
attatttataaaaattattataatatgagttttgcagtaggaactgaaaaaggattagta
gtaccagtattaagggatgcagatcaattgtcatttgctgatattgaaaaaaatattaaa
actatttctgaaaaagcgagagatggaaaaataaccatagaagaccttcagggtggaact
tttacaattagtaatggtggagtgtatggttcaatgttatctactccaatattaaactta
cctcaatctggtgtattaggtatgcataatatagtcgaaagaccaatggtagttgatggt
gagattaaaattagacctattatgtatcttgccttatcttatgatcacagaattatagat
ggaaaagagtcagtatcattcttaaaaatggttaaagaaaatttagaggatccaagaagg
ttatttttaaatatttaa

DBGET integrated database retrieval system