KEGG   Candidatus Pelagibacter ubique: SAR11_0244Help
Entry
SAR11_0244        CDS       T00257                                 

Definition
membrane portion of succinate dehydrogenase
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
pub  Candidatus Pelagibacter ubique
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:pub00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SAR11_0244
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SAR11_0244
   00650 Butanoate metabolism
    SAR11_0244
  Energy metabolism
   00190 Oxidative phosphorylation
    SAR11_0244
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(246931..247257)
Genome map
AA seq 108 aa AA seqDB search
MNSVTKKWLFMKISSVILVPLMIWFILNLVSIFDKDYIEVVNFFTTQPSKILVSLTLVFA
YFFSTLSISEVFEDYIQNEKIKNAANKVLNIFAIIMPIITITVILNLN
NT seq 327 nt NT seq  +upstreamnt  +downstreamnt
atgaactctgtaacaaaaaaatggctgttcatgaaaattagttcagtaattttagtacct
ttaatgatttggtttattctaaatttagtttcaatttttgataaagattatattgaggtt
gttaatttctttaccactcaaccatctaaaattttagtttctttaacactagtatttgct
tactttttttctaccctaagtattagcgaagtatttgaagattatattcagaatgaaaaa
atcaaaaatgccgcaaacaaagtacttaatatttttgctataataatgccaattataaca
ataactgtaatattgaatttaaactaa

DBGET integrated database retrieval system