KEGG   Candidatus Pelagibacter ubique: SAR11_0272Help
Entry
SAR11_0272        CDS       T00257                                 

Gene name
adhP
Definition
alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
pub  Candidatus Pelagibacter ubique
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Class
Metabolism; Overview; Degradation of aromatic compounds [PATH:pub01220]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:pub00010]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:pub00071]
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:pub00350]
Metabolism; Xenobiotics biodegradation and metabolism; Chloroalkane and chloroalkene degradation [PATH:pub00625]
Metabolism; Xenobiotics biodegradation and metabolism; Naphthalene degradation [PATH:pub00626]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(273915..274976)
Genome map
AA seq 353 aa AA seqDB search
MKAQVLHKYNPKMDEKVWVTEQEMPDPKLEKSSDVIVKIGAAGVCRTDLHIIEGVWEHIQ
DPKGDLLPMVMGHENAGWVEEVGKDVVGFKKGDPVILHPIISGTDGTCLSCRRGLDQHAE
EGAFPGLNIKEGGYAELLKTSVRNLIKLPTILAPKDVAPFSDAGLTAYRVVKKATRHLLP
GQTCVIIGAGGLGHIAIQCLKAMCAANIIIVEKSAEALKHAMSLGGDEGVLIDGNEVERV
LELTKGKGGEAVIDFVGEKGSTAMGIKMTAGSGYYYIVGYGEEIRVLAVDVIISEKTIVG
NLVGTWSELYELMELANKGLVTLSMQEYKLGDANKALHDLNEGKVKGRAVLVP
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcacaagttctacataaatataatccaaaaatggatgaaaaagtttgggtgacc
gagcaagaaatgccagatccaaaattagaaaaatcgtcagatgttattgttaaaattggt
gctgcaggagtttgtagaactgatttacacattatcgaaggtgtatgggaacatattcaa
gatcctaaaggagatttattacccatggttatgggtcatgaaaatgcaggttgggttgaa
gaagtgggcaaggatgtcgttggatttaaaaagggtgatccagtaattttgcacccaatc
atttctggaacagatggaacttgtttaagctgtcgtagaggcttagatcagcatgccgaa
gaaggtgcctttccaggactaaacattaaagaaggtggatatgctgaactgcttaaaact
agtgttcgtaacttaattaaactaccaacaatattagcgccaaaagatgttgcaccattt
tctgatgcaggacttaccgcttatagagttgttaaaaaagctactagacatttattacca
ggtcagacttgcgtaattattggagctggtggactgggtcatatagcaattcaatgtttg
aaagcaatgtgtgctgcaaatattattattgttgaaaaatctgctgaagcattaaaacat
gcgatgtcacttggtggtgatgaaggagttttgattgatggtaatgaagttgaaagagtt
ttagaacttaccaaaggtaaaggtggtgaagctgtaatcgattttgttggtgaaaaagga
tccactgcaatgggtatcaaaatgacagcaggaagtggatactattatatcgttggctat
ggtgaagaaatcagagttctagctgtcgatgtaattatttcagaaaaaacaattgttgga
aatttagtgggaacgtggtctgagttatatgagctgatggagttagctaacaaaggttta
gttacgctttctatgcaagaatataaattaggcgatgctaataaagcacttcatgatctt
aacgagggtaaagttaagggaagagctgttttagttccataa

DBGET integrated database retrieval system