KEGG   Candidatus Pelagibacter ubique: SAR11_0272Help
Entry
SAR11_0272        CDS       T00257                                 

Gene name
adhP
Definition
alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K18382  
NAD+-dependent secondary alcohol dehydrogenase Adh1 [EC:1.1.1.-]
Organism
pub  Candidatus Pelagibacter ubique
Pathway
Propanoate metabolism
Brite
KEGG Orthology (KO) [BR:pub00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    SAR11_0272 (adhP)
Enzymes [BR:pub01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     SAR11_0272 (adhP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(273915..274976)
Genome map
AA seq 353 aa AA seqDB search
MKAQVLHKYNPKMDEKVWVTEQEMPDPKLEKSSDVIVKIGAAGVCRTDLHIIEGVWEHIQ
DPKGDLLPMVMGHENAGWVEEVGKDVVGFKKGDPVILHPIISGTDGTCLSCRRGLDQHAE
EGAFPGLNIKEGGYAELLKTSVRNLIKLPTILAPKDVAPFSDAGLTAYRVVKKATRHLLP
GQTCVIIGAGGLGHIAIQCLKAMCAANIIIVEKSAEALKHAMSLGGDEGVLIDGNEVERV
LELTKGKGGEAVIDFVGEKGSTAMGIKMTAGSGYYYIVGYGEEIRVLAVDVIISEKTIVG
NLVGTWSELYELMELANKGLVTLSMQEYKLGDANKALHDLNEGKVKGRAVLVP
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcacaagttctacataaatataatccaaaaatggatgaaaaagtttgggtgacc
gagcaagaaatgccagatccaaaattagaaaaatcgtcagatgttattgttaaaattggt
gctgcaggagtttgtagaactgatttacacattatcgaaggtgtatgggaacatattcaa
gatcctaaaggagatttattacccatggttatgggtcatgaaaatgcaggttgggttgaa
gaagtgggcaaggatgtcgttggatttaaaaagggtgatccagtaattttgcacccaatc
atttctggaacagatggaacttgtttaagctgtcgtagaggcttagatcagcatgccgaa
gaaggtgcctttccaggactaaacattaaagaaggtggatatgctgaactgcttaaaact
agtgttcgtaacttaattaaactaccaacaatattagcgccaaaagatgttgcaccattt
tctgatgcaggacttaccgcttatagagttgttaaaaaagctactagacatttattacca
ggtcagacttgcgtaattattggagctggtggactgggtcatatagcaattcaatgtttg
aaagcaatgtgtgctgcaaatattattattgttgaaaaatctgctgaagcattaaaacat
gcgatgtcacttggtggtgatgaaggagttttgattgatggtaatgaagttgaaagagtt
ttagaacttaccaaaggtaaaggtggtgaagctgtaatcgattttgttggtgaaaaagga
tccactgcaatgggtatcaaaatgacagcaggaagtggatactattatatcgttggctat
ggtgaagaaatcagagttctagctgtcgatgtaattatttcagaaaaaacaattgttgga
aatttagtgggaacgtggtctgagttatatgagctgatggagttagctaacaaaggttta
gttacgctttctatgcaagaatataaattaggcgatgctaataaagcacttcatgatctt
aacgagggtaaagttaagggaagagctgttttagttccataa

DBGET integrated database retrieval system