KEGG   Candidatus Pelagibacter ubique: SAR11_0430Help
Entry
SAR11_0430        CDS       T00257                                 

Gene name
aceF
Definition
dihydrolipoamide S-acetyltransferase (EC:2.3.1.12)
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
pub  Candidatus Pelagibacter ubique
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pub00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SAR11_0430 (aceF)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAR11_0430 (aceF)
   00020 Citrate cycle (TCA cycle)
    SAR11_0430 (aceF)
   00620 Pyruvate metabolism
    SAR11_0430 (aceF)
Enzymes [BR:pub01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     SAR11_0430 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
419944..421215
Genome map
AA seq 423 aa AA seqDB search
MSDKEIKVPNIGEFKDVEVIEVLVSNGQSVSKNDPLITIESDKSSVEIPASFDGKIKSVK
IKVGDRVSEGDLILTIEQSGEEEKKIEQKTIKEAEQVTNQNQVEKIAKVNPAQNTIKKDN
SEISSASPKVRKFARELGVNINEIVGSERQGRIVEDDVKNFISSRINKAPDKTEVQPKKI
VSEYSHSDFGEIEVKDMPRVKKLASTYLVNSWTTIPHVTNHDEADITEMEDFRTSLTDMY
TGERKKITPLAFIVKALVASLKKFPSFNSSIDDIENGKITMKNYFHVGIAVDTPHGLMVP
KIRNADNKSISYISNELKIVSDQCRNLKIDKKEFFGGSMTITSLGGIGGSFFTPIINYPE
VAILGVGKAQKKQIFINGKFETRTMLPLSLSYDHRIIDGAEAARFNNDLKENLGKNFAYK
LAV
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgtcagataaagagattaaagtaccaaatattggtgaatttaaagacgttgaggtaatt
gaggtgctagtttcaaatggccagtcagtttctaaaaatgatccacttattacaattgag
agtgacaaatctagtgttgaaataccagcttcttttgatggaaagattaagtctgttaaa
attaaagtgggagatagggtttcagaaggtgatttaatattaactatagaacagtctgga
gaagaagaaaaaaaaatagaacaaaaaactattaaagaagcagaacaagttacaaatcaa
aatcaagtagaaaaaattgcaaaagtcaatccagcacaaaatacaataaaaaaagataat
tcagaaatttcatctgcaagcccaaaagtacgtaaatttgctagagaacttggggttaat
attaatgaaatagttggtagtgaaagacagggaagaattgtggaagatgatgtaaaaaat
tttatatcctctagaattaataaagctccagataagaccgaagttcaaccaaaaaaaatt
gttagtgaatattctcattctgattttggtgaaattgaagttaaagatatgcctagagtt
aaaaaattagcctctacatatttagttaattcttggactacaatacctcatgtcacaaat
catgatgaagcagatataactgaaatggaagattttagaacttcacttactgacatgtat
acaggggaaagaaaaaaaattactccattagcttttattgttaaagctttagttgcatct
ttaaaaaagtttcctagtttcaactcttcaatagatgatattgaaaatggaaaaattaca
atgaaaaactattttcatgttgggattgcagtggatactccacatggtttaatggtgcca
aaaattagaaatgctgacaataaaagcatctcatatattagcaatgaattgaaaatagta
agtgaccaatgtagaaatttaaaaatagataagaaagaattttttggaggatctatgact
attacgagtcttggaggaattggaggttcattctttacaccaataataaattatccagaa
gttgctatattaggagtaggcaaggcacaaaaaaaacaaatttttattaatgggaaattt
gaaacaagaacaatgctaccgctttctttatcatatgatcacagaataattgatggagct
gaagcagctagatttaataatgatctaaaagaaaatttaggcaaaaattttgcttataaa
ttagctgtatag

DBGET integrated database retrieval system