KEGG   Candidatus Pelagibacter ubique: SAR11_0487Help
Entry
SAR11_0487        CDS       T00257                                 

Gene name
trpA
Definition
(GenBank) Tryptophan synthase alpha chain (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
pub  Candidatus Pelagibacter ubique
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pub00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SAR11_0487 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SAR11_0487 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SAR11_0487 (trpA)
Enzymes [BR:pub01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SAR11_0487 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(476337..477134)
Genome map
AA seq 265 aa AA seqDB search
MSLINLAFKKVKTEKRPALLTYTVAGDSTKKKSLEILKSIAKYADICEIGFPHNTPIADG
GQIQSSAYRALKNGIKIKDVFSIVKNFKKSKQSKPVILMGYYNMIYQYGDNNFINICKKV
GVDGLIVVDLPYPENKEFAKKCKKKDISFIQLVSPTTSLDRMKKIIRDSHDMVYYISMLS
TTGGKLKVSPKKILERYGKIKKLNKNKNIVIGFGITEKTIASLRKADGLVVGSALCKEIS
NSIKKRQNPVTNVTNIVLKLRKKIS
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgtcattaatcaacttagcatttaaaaaagtaaaaactgaaaagagacctgcattacta
acttacacggtagctggagatagtactaaaaagaagtctcttgagatattaaaatcaatt
gcaaaatatgctgacatttgcgaaataggatttcctcataacactccaattgcagatggt
ggacagattcaatcaagcgcttatagagctctaaaaaatggtatcaaaattaaagatgtt
ttttcaatagttaaaaattttaaaaaatcaaaacaatcaaaacccgtaatattgatgggt
tattataatatgatttatcaatatggagataataactttataaatatttgtaaaaaagta
ggagtagatggattaattgttgttgaccttccttatccagaaaataaagaatttgcaaaa
aaatgtaagaaaaaagatattagttttattcaattagtatctcctactacgtctctggac
agaatgaaaaaaattataagagactcacatgatatggtctattatatcagtatgctctca
acaactggtggcaagctaaaggtttcgcctaaaaaaattttagagcgttacggtaaaatt
aaaaaacttaacaagaataagaatattgtaataggctttgggatcactgaaaaaaccata
gcatctttaagaaaggctgatggattagtggttggcagtgctttatgtaaagaaatatca
aattctattaaaaaacgccaaaatcctgtcacaaatgtaactaatattgtgttaaagtta
agaaaaaaaatatcatga

DBGET integrated database retrieval system