KEGG   Candidatus Pelagibacter ubique: SAR11_0487Help
Entry
SAR11_0487        CDS       T00257                                 

Gene name
trpA
Definition
(GenBank) Tryptophan synthase alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
pub  Candidatus Pelagibacter ubique
Pathway
pub00260  Glycine, serine and threonine metabolism
pub00400  Phenylalanine, tyrosine and tryptophan biosynthesis
pub01100  Metabolic pathways
pub01110  Biosynthesis of secondary metabolites
pub01130  Biosynthesis of antibiotics
pub01230  Biosynthesis of amino acids
Module
pub_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pub00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SAR11_0487 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SAR11_0487 (trpA)
Enzymes [BR:pub01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SAR11_0487 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA Ribul_P_3_epim Metallophos
Motif
Other DBs
NCBI-ProteinID: AAZ21309
UniProt: Q4FND0
Position
complement(476337..477134)
Genome map
AA seq 265 aa AA seqDB search
MSLINLAFKKVKTEKRPALLTYTVAGDSTKKKSLEILKSIAKYADICEIGFPHNTPIADG
GQIQSSAYRALKNGIKIKDVFSIVKNFKKSKQSKPVILMGYYNMIYQYGDNNFINICKKV
GVDGLIVVDLPYPENKEFAKKCKKKDISFIQLVSPTTSLDRMKKIIRDSHDMVYYISMLS
TTGGKLKVSPKKILERYGKIKKLNKNKNIVIGFGITEKTIASLRKADGLVVGSALCKEIS
NSIKKRQNPVTNVTNIVLKLRKKIS
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgtcattaatcaacttagcatttaaaaaagtaaaaactgaaaagagacctgcattacta
acttacacggtagctggagatagtactaaaaagaagtctcttgagatattaaaatcaatt
gcaaaatatgctgacatttgcgaaataggatttcctcataacactccaattgcagatggt
ggacagattcaatcaagcgcttatagagctctaaaaaatggtatcaaaattaaagatgtt
ttttcaatagttaaaaattttaaaaaatcaaaacaatcaaaacccgtaatattgatgggt
tattataatatgatttatcaatatggagataataactttataaatatttgtaaaaaagta
ggagtagatggattaattgttgttgaccttccttatccagaaaataaagaatttgcaaaa
aaatgtaagaaaaaagatattagttttattcaattagtatctcctactacgtctctggac
agaatgaaaaaaattataagagactcacatgatatggtctattatatcagtatgctctca
acaactggtggcaagctaaaggtttcgcctaaaaaaattttagagcgttacggtaaaatt
aaaaaacttaacaagaataagaatattgtaataggctttgggatcactgaaaaaaccata
gcatctttaagaaaggctgatggattagtggttggcagtgctttatgtaaagaaatatca
aattctattaaaaaacgccaaaatcctgtcacaaatgtaactaatattgtgttaaagtta
agaaaaaaaatatcatga

DBGET integrated database retrieval system