KEGG   Candidatus Pelagibacter ubique: SAR11_0488Help
Entry
SAR11_0488        CDS       T00257                                 

Gene name
trpB
Definition
(GenBank) Tryptophan synthase beta chain 1
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
pub  Candidatus Pelagibacter ubique
Pathway
pub00260  Glycine, serine and threonine metabolism
pub00400  Phenylalanine, tyrosine and tryptophan biosynthesis
pub01100  Metabolic pathways
pub01110  Biosynthesis of secondary metabolites
pub01130  Biosynthesis of antibiotics
pub01230  Biosynthesis of amino acids
Module
pub_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pub00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SAR11_0488 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SAR11_0488 (trpB)
Enzymes [BR:pub01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SAR11_0488 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Dicer_dimer BORCS6
Motif
Other DBs
NCBI-ProteinID: AAZ21310
UniProt: Q4FNC9
Position
complement(477136..478368)
Genome map
AA seq 410 aa AA seqDB search
MKLKKKIPLIDQHNKNGFWGGKFGGNFIPETLKKPIEDLTELFEKLRYDKKFLKERDYYF
KNYIGSPTSFIKLQNLSDHLSGAQIYAKMVSEANGGAHKIYNATVHCLIAKKAGKKYVVG
DTGAGYAGKMLSMAAKKFGLKCKIFMGAKDIKRQKPNVDAMKKNGAEVVPVYSGSQTLVD
AVSECMRYWVSNCDNTHMCVGSTVGPNIFVKICGWSTAQISRELKVQIQSEFKKMPKKIK
LINCVGGGSSAYGFWSEFIDYDKKQIELIGVEAGGPKNSKLHAAPLTNGAKLGILHGAAA
YVCQNSEGQINDTASISAGLDYPGVSPIHCFLKDTKRARYTSATDEAALNAYKLVTKLEK
INPSLEPSHAFAEAIKIAPKLNKDTIIIVNSCGDAKKDRDILKERLGKIN
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atgaaacttaaaaaaaaaattcctttaattgatcagcacaacaaaaatggattttggggt
ggtaaatttggtggaaattttatacctgaaacattaaaaaagcccattgaggatttaact
gaactttttgaaaaacttagatacgataaaaaatttcttaaagaaagagactattatttt
aagaattatataggctctcctacttcatttattaaacttcaaaacctatcagatcactta
agtggagctcaaatatatgccaaaatggtgtctgaggcgaacggaggagctcataaaatt
tataatgcaacagttcattgccttattgctaaaaaggcagggaaaaaatatgtcgttggt
gatacgggtgcagggtatgctggaaagatgctgagtatggctgctaaaaaatttggcctt
aaatgcaaaatattcatgggtgcaaaggatattaaaagacaaaagcctaatgtagatgca
atgaaaaagaatggtgcagaagttgtacctgtttattcaggaagccaaacattagtagat
gctgtcagtgaatgcatgcgttattgggtttcaaattgcgataacacccatatgtgtgtt
ggatcaacagtaggccctaatatatttgttaaaatttgtggctggagtacagctcaaatt
tcaagagaattgaaagttcaaattcagtcagaatttaaaaagatgcctaaaaaaattaaa
ctcattaattgtgttggaggtggaagttcagcttatgggttttggagtgagtttattgat
tatgacaaaaaacagattgaattaattggtgttgaagctggtggaccaaaaaattcaaaa
ctacatgcagcacctctaactaatggagctaaacttgggatattgcatggagctgcagct
tatgtttgtcaaaatagtgaaggacaaattaacgataccgcttctatttctgctggatta
gattatcctggggtatcccctattcactgcttcttaaaagatactaaaagagcaagatat
acatctgcaactgatgaggcggctttaaatgcatacaaactagttacaaaacttgaaaaa
ataaacccaagtcttgaacctagtcatgcttttgctgaagctataaaaattgctccaaaa
ttaaacaaagatactatcattattgttaattcttgtggtgatgccaaaaaggatcgtgat
attttaaaagaaagattgggaaaaattaactaa

DBGET integrated database retrieval system