KEGG   Candidatus Pelagibacter ubique: SAR11_0504Help
Entry
SAR11_0504        CDS       T00257                                 

Gene name
cycM
Definition
(GenBank) cytochrome C
  KO
K08738  cytochrome c
Organism
pub  Candidatus Pelagibacter ubique
Pathway
pub02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pub00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    SAR11_0504 (cycM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Pilin_N
Motif
Other DBs
NCBI-ProteinID: AAZ21326
UniProt: Q4FNB3
Position
complement(491305..491844)
Genome map
AA seq 179 aa AA seqDB search
MDSFELNKIIAAILMVALLVIGLGKVADGVFHVNKPENPGYQVEVEGQPASTVSQVAEVE
QKVDIAAIMALGDVTLGEKIFKKCAACHSIEKGGPNKIGPALYNVVGSKVGAVEDYKYSK
TLASYGKDWTFEELNGFLTKPSSYLKGTKMSYAGLRKEADRASIIKYLNQNSDSPKQLP
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atggattcgttcgagcttaataaaattattgctgctattttaatggttgcacttcttgta
attggtttaggaaaagttgccgacggtgtctttcatgtaaataaaccagaaaatccaggg
tatcaagttgaagtagaaggacaaccagcttccacagtatctcaagttgctgaagttgag
caaaaagtagacattgccgctataatggctctaggcgatgtaactttaggtgaaaaaatt
tttaaaaaatgtgcagcatgtcactctattgaaaaaggtggtccaaataaaattggtcct
gctctttataacgtagtgggcagtaaagtaggtgctgtagaagactacaaatattctaaa
actttagcctcatatggtaaagactggacttttgaagaactcaatggttttttaacaaaa
cctagctcatatttgaaaggaacaaaaatgtcttacgctggcttgagaaaagaagcagat
agagcctcgattattaagtacctaaatcaaaatagtgatagccctaaacagctaccttaa

DBGET integrated database retrieval system