KEGG   Candidatus Pelagibacter ubique: SAR11_0504Help
Entry
SAR11_0504        CDS       T00257                                 

Gene name
cycM
Definition
cytochrome C
Orthology
K08738  
cytochrome c
Organism
pub  Candidatus Pelagibacter ubique
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:pub00920]
Environmental Information Processing; Signal transduction; Two-component system [PATH:pub02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(491305..491844)
Genome map
AA seq 179 aa AA seqDB search
MDSFELNKIIAAILMVALLVIGLGKVADGVFHVNKPENPGYQVEVEGQPASTVSQVAEVE
QKVDIAAIMALGDVTLGEKIFKKCAACHSIEKGGPNKIGPALYNVVGSKVGAVEDYKYSK
TLASYGKDWTFEELNGFLTKPSSYLKGTKMSYAGLRKEADRASIIKYLNQNSDSPKQLP
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atggattcgttcgagcttaataaaattattgctgctattttaatggttgcacttcttgta
attggtttaggaaaagttgccgacggtgtctttcatgtaaataaaccagaaaatccaggg
tatcaagttgaagtagaaggacaaccagcttccacagtatctcaagttgctgaagttgag
caaaaagtagacattgccgctataatggctctaggcgatgtaactttaggtgaaaaaatt
tttaaaaaatgtgcagcatgtcactctattgaaaaaggtggtccaaataaaattggtcct
gctctttataacgtagtgggcagtaaagtaggtgctgtagaagactacaaatattctaaa
actttagcctcatatggtaaagactggacttttgaagaactcaatggttttttaacaaaa
cctagctcatatttgaaaggaacaaaaatgtcttacgctggcttgagaaaagaagcagat
agagcctcgattattaagtacctaaatcaaaatagtgatagccctaaacagctaccttaa

DBGET integrated database retrieval system