KEGG   Candidatus Pelagibacter ubique: SAR11_0509Help
Entry
SAR11_0509        CDS       T00257                                 

Gene name
recR
Definition
recR-like protein
Orthology
K06187  
recombination protein RecR
Organism
pub  Candidatus Pelagibacter ubique
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:pub00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    SAR11_0509 (recR)
DNA repair and recombination proteins [BR:pub03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      SAR11_0509 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
495664..496275
Genome map
AA seq 203 aa AA seqDB search
MQNINEIEELIKLISKLPGLGPKSAKRIVLKLINNRDELVKPMANTLAQVYKNVIRCQSC
GTLKSNSLGCNNCENSKEKYNKICVVEDIADQWSIENSNIYKGYFHILGGTISSAGQRKE
DLLINSLVERVSRENIEEVILATSATVEGQTTAYYIEDSLKKTSTKVTKLAQGLPVGGEI
ESLDDGTLYSAFKNRTGIKTNSD
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaatattaatgagatagaagagttaattaaattaatttctaaacttcctggctta
ggtcctaaatctgcaaaaagaattgttttaaaacttattaataatagggatgaacttgta
aaaccaatggcaaacactttggcgcaagtttataaaaatgttattaggtgtcaatcttgt
ggtactttaaaatctaattcattaggctgtaacaattgtgaaaattcaaaagaaaaatat
aataaaatatgtgtagttgaagacattgcagatcaatggtcaattgaaaattctaatatc
tataaaggctactttcatattcttggtggcactatttcttctgctggccagagaaaagaa
gatcttttgattaattcattagtagaaagagtttcaagagaaaatattgaagaagttata
ctagcaacaagtgcaacagtagaaggtcaaactaccgcttattacatagaggatagttta
aaaaaaacttctactaaggttacaaaacttgctcaaggacttcctgttggtggcgaaata
gaaagtctcgatgatggaactttatattcagcttttaaaaacagaactggaattaaaact
aattctgactag

DBGET integrated database retrieval system