KEGG   Candidatus Pelagibacter ubique: SAR11_0510Help
Entry
SAR11_0510        CDS       T00257                                 

Gene name
glcB
Definition
malate synthase G (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
pub  Candidatus Pelagibacter ubique
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:pub01200]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:pub00620]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:pub00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(496262..498457)
Genome map
AA seq 731 aa AA seqDB search
MGAMKEQYTKIHNLSVSNKLLNFVNEELLKDTNISSEKFWEGFDQVVHELAPKNKELLKI
REDLQKKIDDWHIANKGNEINLEEYKKFLKEIDYLKEVGPDFKIKTNNVDEEITSIAGPQ
LVVPIMNERYALNAANARWMSLYDSLYGTDVIDQSEDSPTQRYDPLRGEMVIKYGRDFLE
KYFPLENFEWHNITAFKIDNGSLTVLKDSNKSSLKNKDKYIGHRGEANDPSAIILKNNNL
HIEIIIDPNAFSAQQDPAKISDIIVEAAVSTICDNEDSVAAVDADDKVICYRNWLGLMKG
DLKSTFEKNGKTYERKLNPDRSYISKDGKGLKLHGRSLLLVRNVGHLMTNSAITLKDGSE
IPEGIMDAFITSAACLHDIKKKGNSRTGSIYIVKPKMHGPDETSFTDLIFTKVEEVLGLE
KYTCKIGIMDEERRTSSNLKECIRTLQNRVFFINTGFLDRTGDEMHTSMEAGPMIKKGDM
KSSKWIGAYENNNVDIGLQCGLSGKAQIGKGMWAMPDKMKEMMEQKTSHLNAGANCAWVP
SPTAAALHALHYHEINIFEKQKEIQKRESAKLDDLLTIPVADRPNWSMEEINSEISNSAQ
TLLGYVVRWIDHGVGCSKVPDINNVGLMEDRATLRISSQHIANWIHHDICTKSQVMEVMK
KMAKIVDDQNKNDGAYTRSGRGSYEMMSENFEQSIAFKTACDLIFKGKEQPSGYTEPLLH
LNRLLKKSSQN
NT seq 2196 nt NT seq  +upstreamnt  +downstreamnt
atgggtgctatgaaagaacaatatacaaaaatacacaatctatcagtttctaataaattg
cttaacttcgttaatgaagagctgcttaaagatacaaatatttcttctgaaaaattctgg
gaaggcttcgaccaagtagttcatgagctagccccaaaaaataaagagctattaaaaata
agagaagatttacaaaaaaaaatagacgattggcatattgcaaataaaggaaatgaaatc
aatctagaggagtataaaaaatttttaaaagaaattgattatttaaaagaagtaggccct
gattttaagatcaaaacaaataatgttgatgaagaaataactagtattgctggacctcaa
ttagtagttccaatcatgaatgaaaggtatgcactgaatgcagctaatgctagatggatg
agtttatatgacagtttatatggtacagatgtaatcgatcaatctgaggatagtcccact
caaagatacgatcctttaagaggagaaatggttataaaatatggaagagactttttagaa
aaatattttcctctagaaaattttgaatggcataatattacagcctttaaaattgataat
ggctctttaacagtattaaaagatagtaataaatcatctttaaaaaataaagataaatat
attggtcatagaggagaggccaatgatccatcagcaataattttaaaaaataataatctt
catatagaaataattatagacccaaatgcttttagcgctcaacaagatcctgctaaaatt
agtgatattattgttgaagctgcagtttcaactatttgtgataatgaagatagtgttgct
gcagtagatgctgatgacaaagttatttgttatcgtaattggcttggacttatgaaaggt
gatttgaaatcaacttttgaaaaaaatggaaagacttatgagcgtaaattaaatcccgac
agaagttatatttctaaagatggaaaaggattaaagctacatggaagaagtttattattg
gtaaggaatgttggacaccttatgactaactcagcaatcactttaaaagatggttctgaa
ataccagaaggtattatggatgcctttataacttcagcagcttgccttcatgatattaaa
aaaaaaggtaattctagaactggttctatttatattgttaaaccaaaaatgcatggtcct
gatgaaacctcatttactgatttaatttttactaaagttgaagaagttttaggattggaa
aaatacacttgtaaaattggaattatggatgaagagagaagaacctcatctaatttaaaa
gagtgtattagaacacttcaaaatagagtattttttattaatactggttttttagatcgt
actggtgatgaaatgcatacttcaatggaagctggtcctatgattaaaaaaggagatatg
aaatcttctaaatggattggggcatatgaaaataacaatgtagacataggtcttcaatgt
ggtctttctggtaaggctcaaattggcaaaggaatgtgggctatgccggacaaaatgaaa
gagatgatggaacaaaaaactagccatctaaatgctggtgcaaattgtgcttgggttccc
tcacctacagcggcagctcttcatgctcttcattatcatgaaataaatatttttgagaaa
cagaaagaaattcaaaaaagagaatctgcaaaactggatgatttgttaacaattcctgta
gcagacagaccaaactggtcaatggaagaaattaactccgaaatttccaattctgcacaa
actcttttagggtatgtcgtcagatggatagatcatggagttggctgttcaaaggtacct
gatattaataatgttggtttgatggaggatagagccactttaagaatttcttctcaacat
atagctaattggatacatcacgatatttgtacaaaatcacaagttatggaagtaatgaaa
aaaatggcaaaaattgttgatgatcaaaataaaaatgatggtgcctatactcgctccgga
agaggaagctacgaaatgatgtctgaaaattttgagcaatcaattgcttttaagacagct
tgtgatttaatctttaaaggtaaagagcaaccttcgggttacacagaaccgttattacat
ctaaatcgattattaaagaaatctagtcagaattag

DBGET integrated database retrieval system