KEGG   Candidatus Pelagibacter ubique: SAR11_0528Help
Entry
SAR11_0528        CDS       T00257                                 

Gene name
smtA
Definition
protein-L-isoaspartate(D-aspartate) O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
pub  Candidatus Pelagibacter ubique
Brite
Enzymes [BR:pub01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     SAR11_0528 (smtA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
520922..521581
Genome map
AA seq 219 aa AA seqDB search
MEIDFITNHHKQTKRDYLARVNKINKSEAAVKAKKWDFDYWDGSRDVNYGGYYYDGRWEP
IAKKIIDFYKIKPGNKILDIGCGKGFLLYELKKQVPGVIIRGLDISSYAIKNAKEEVKEY
LKIGDANKLPYSDKEFDLVLSINTLHNLYCFDLFSALQEIERVGKEKKYLCVESYRNETE
KVNLLYWQVTCEAFFNTEEWKWIFNQNNYRGDYSFIFFE
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atggaaattgattttataacaaaccatcataaacaaaccaaaagagactatttggccaga
gtaaataagataaacaaatctgaggcagcggtaaaagctaaaaaatgggattttgattac
tgggatggttcaagagatgttaattatggaggttactattatgatggaaggtgggagcca
atagcaaaaaaaattatagatttttataaaataaaaccaggtaacaaaattttagatatt
gggtgtggaaagggttttttattatatgaattaaaaaaacaagtacctggagtaattata
agaggactagatatctcaagttatgcaattaaaaatgcaaaagaagaggtaaaagaatac
ttaaagataggagatgcaaacaaattaccatattctgataaagagtttgatttggtttta
agtataaatactttgcataatttgtactgctttgatctattttcagcattacaagaaata
gaacgagttggaaaagaaaaaaaatatctttgtgtagagtcttatcgaaatgagacagaa
aaagtaaatttattatattggcaagtgacttgtgaagcgtttttcaatacagaagagtgg
aaatggatttttaatcaaaacaattatagaggtgattattcatttattttttttgaataa

DBGET integrated database retrieval system