KEGG   Candidatus Pelagibacter ubique: SAR11_0547Help
Entry
SAR11_0547        CDS       T00257                                 

Definition
D amino acid oxidase (DAO) family protein (EC:1.4.3.3)
Orthology
K00273  
D-amino-acid oxidase [EC:1.4.3.3]
Organism
pub  Candidatus Pelagibacter ubique
Pathway
Glycine, serine and threonine metabolism
Arginine and proline metabolism
D-Arginine and D-ornithine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pub00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SAR11_0547
   00330 Arginine and proline metabolism
    SAR11_0547
  Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    SAR11_0547
  Biosynthesis of other secondary metabolites
   00311 Penicillin and cephalosporin biosynthesis
    SAR11_0547
Enzymes [BR:pub01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.3  D-amino-acid oxidase
     SAR11_0547
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(539250..540239)
Genome map
AA seq 329 aa AA seqDB search
MYVDLYERKEDILLSASGKNQMRAHIGYHYPRSKDTVKEVQKSTKKFQSFFPKNIFEKTK
NFYAITNKKTKTNSRQYLDFLKKNNLYFRNLKKFQFFEKKNIDSVFLVKEKIINIFNARK
FLKNKILNNKKIKLSLNTKFNKSNIEDYDKIIYATYEENNLNIKGLTKDIIKKRYELVEK
ILVKMPSIFSKTSIVVLDGNFVCIDPYLGTNLHLLSDVKNSKIEIQNKRFVKFNNYKKKY
LSKQLVKNVKVSLFKKFIKDSKKYLPILTKAKYHGSFFVVRAINHNKNDTRKTEVKKLSE
KIFTIYSGKWITAVSTAIKLKLQIKKSLK
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
gtgtacgttgatttatatgaaagaaaagaagatattttactatcggcatcaggtaaaaac
caaatgagggctcatataggttaccactatccaagatctaaagacacagttaaagaggtt
caaaaatcaacaaaaaaatttcaatcattttttccaaaaaatatatttgaaaaaacaaaa
aatttttacgcaataacaaataaaaaaactaaaacaaattctcgtcaatatttagatttt
ttgaaaaaaaataatttatattttagaaatttaaaaaaatttcaattttttgaaaaaaaa
aatattgatagtgtttttttagttaaagaaaaaattataaatatatttaatgcaagaaaa
tttttaaaaaacaaaattttaaataataaaaaaattaaattatctcttaatacgaaattt
aataagagtaatatagaagattatgataaaatcatttatgccacctatgaagaaaataat
ttaaatattaaaggtttaacaaaagatattataaaaaaaagatatgaacttgttgagaaa
attcttgttaaaatgccgtcaatattttctaaaactagtatagttgttttagatggtaac
tttgtctgtattgatccatatttgggaacaaatttacacttgttaagtgatgttaaaaat
tcaaaaattgagattcaaaacaaaaggtttgttaaattcaataactacaaaaaaaaatat
ttaagtaagcaattagttaaaaatgtgaaagtttctctttttaaaaaatttattaaagat
tcgaagaaatatttacccatactaactaaagcgaaatatcatggatctttttttgttgta
agagcaatcaatcataataaaaatgacacgagaaaaactgaagtaaaaaaattatcagaa
aaaatttttacaatatatagcggtaaatggattactgcagtttcaacagcaattaagtta
aaacttcaaataaaaaaaagcctaaaataa

DBGET integrated database retrieval system