KEGG   Candidatus Pelagibacter ubique: SAR11_0602Help
Entry
SAR11_0602        CDS       T00257                                 

Gene name
folP
Definition
dihydropteroate synthase-like protein (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
pub  Candidatus Pelagibacter ubique
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:pub00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
587974..589026
Genome map
AA seq 350 aa AA seqDB search
MKKYYTRACNFAYGQFSIELVRKKKNLPLNGNKKISFGQIEILTRTSIKKIDLKDIKKLP
KLLKKKINKDLKTIVKKNKNFSSLNFNKIPNIMGILNLTPDSFSDGGKFNKKKKGISHAK
NLFKSGADIIDVGGESTRPGSKPVSKKEEWNRIKEILKDVNKKIPLSLDTRKSEIMIKGI
HLGVKLINDVSGLSYDPKTVKVLIKSKTPFVIQHSQGTPEKMQKNPKYKNELLDIYDFFE
QKIKFLRSMGIKHNNIVIDPGIGFGKNLKHNMNLIRSVSIFHTLGFPILLGLSRKKFIKD
LSGKNDSKERLGGTVSSSMYAIMQGVQILRIHDVNELRQSIKVFKELIKN
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaatattacacaagagcgtgtaattttgcttatggtcaattttcaattgaatta
gttagaaaaaaaaaaaatcttccactaaatggtaataagaaaatttcttttggacaaatt
gaaattcttacacgaacttctatcaaaaaaattgatcttaaagatataaaaaaattaccc
aaactactgaaaaaaaaaattaataaagatctcaagactatcgttaaaaaaaataaaaac
ttttcaagtttaaattttaataaaatacctaatataatgggtatattaaatttaacacca
gatagtttttctgatgggggtaaatttaataaaaagaaaaaaggaatatctcatgcaaag
aatttatttaaatctggagcagatattattgatgttggtggagaatcaacaagacctgga
tctaaacctgtaagtaaaaaggaagaatggaatagaataaaagaaatattaaaagatgtt
aataaaaaaattccactatcattagatacaagaaaatcagaaattatgattaaagggatt
catttaggagttaaacttataaatgacgtgtcaggtctaagttatgaccctaaaacagtt
aaggtattgataaaaagcaaaactccatttgtcattcaacattcacaaggtacaccagaa
aaaatgcaaaaaaaccctaagtacaaaaatgaattattagatatttatgatttttttgaa
caaaagattaaatttttaagatccatgggtataaaacataataatattgtaattgatcca
ggaattggttttggaaaaaatttgaaacataatatgaatttaattagaagcgtttctatt
tttcatactcttggttttcctatattacttggactttctaggaaaaaatttattaaggat
ttatctggaaaaaatgatagcaaggaaagattaggtggaacagtatcttcttccatgtat
gcaataatgcaaggagttcaaattctaagaattcatgatgtgaatgaattaagacaaagt
ataaaagtgtttaaagaattaattaaaaactaa

DBGET integrated database retrieval system