KEGG   Candidatus Pelagibacter ubique: SAR11_0602Help
Entry
SAR11_0602        CDS       T00257                                 

Gene name
folP
Definition
dihydropteroate synthase-like protein (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
pub  Candidatus Pelagibacter ubique
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pub00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SAR11_0602 (folP)
Enzymes [BR:pub01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     SAR11_0602 (folP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
587974..589026
Genome map
AA seq 350 aa AA seqDB search
MKKYYTRACNFAYGQFSIELVRKKKNLPLNGNKKISFGQIEILTRTSIKKIDLKDIKKLP
KLLKKKINKDLKTIVKKNKNFSSLNFNKIPNIMGILNLTPDSFSDGGKFNKKKKGISHAK
NLFKSGADIIDVGGESTRPGSKPVSKKEEWNRIKEILKDVNKKIPLSLDTRKSEIMIKGI
HLGVKLINDVSGLSYDPKTVKVLIKSKTPFVIQHSQGTPEKMQKNPKYKNELLDIYDFFE
QKIKFLRSMGIKHNNIVIDPGIGFGKNLKHNMNLIRSVSIFHTLGFPILLGLSRKKFIKD
LSGKNDSKERLGGTVSSSMYAIMQGVQILRIHDVNELRQSIKVFKELIKN
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaatattacacaagagcgtgtaattttgcttatggtcaattttcaattgaatta
gttagaaaaaaaaaaaatcttccactaaatggtaataagaaaatttcttttggacaaatt
gaaattcttacacgaacttctatcaaaaaaattgatcttaaagatataaaaaaattaccc
aaactactgaaaaaaaaaattaataaagatctcaagactatcgttaaaaaaaataaaaac
ttttcaagtttaaattttaataaaatacctaatataatgggtatattaaatttaacacca
gatagtttttctgatgggggtaaatttaataaaaagaaaaaaggaatatctcatgcaaag
aatttatttaaatctggagcagatattattgatgttggtggagaatcaacaagacctgga
tctaaacctgtaagtaaaaaggaagaatggaatagaataaaagaaatattaaaagatgtt
aataaaaaaattccactatcattagatacaagaaaatcagaaattatgattaaagggatt
catttaggagttaaacttataaatgacgtgtcaggtctaagttatgaccctaaaacagtt
aaggtattgataaaaagcaaaactccatttgtcattcaacattcacaaggtacaccagaa
aaaatgcaaaaaaaccctaagtacaaaaatgaattattagatatttatgatttttttgaa
caaaagattaaatttttaagatccatgggtataaaacataataatattgtaattgatcca
ggaattggttttggaaaaaatttgaaacataatatgaatttaattagaagcgtttctatt
tttcatactcttggttttcctatattacttggactttctaggaaaaaatttattaaggat
ttatctggaaaaaatgatagcaaggaaagattaggtggaacagtatcttcttccatgtat
gcaataatgcaaggagttcaaattctaagaattcatgatgtgaatgaattaagacaaagt
ataaaagtgtttaaagaattaattaaaaactaa

DBGET integrated database retrieval system