KEGG   Candidatus Pelagibacter ubique: SAR11_0709Help
Entry
SAR11_0709        CDS       T00257                                 

Gene name
gmk
Definition
(GenBank) Guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
pub  Candidatus Pelagibacter ubique
Pathway
pub00230  Purine metabolism
pub01100  Metabolic pathways
Module
pub_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:pub00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    SAR11_0709 (gmk)
Enzymes [BR:pub01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     SAR11_0709 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 MMR_HSR1 Rad17 AAA_33 Thymidylate_kin ABC_tran RsgA_GTPase TsaE dNK cobW AAA_22 AAA AAA_24 AAA_16 AAA_29 RuvB_N
Motif
Other DBs
NCBI-ProteinID: AAZ21528
UniProt: Q4FMR1
Position
691948..692580
Genome map
AA seq 210 aa AA seqDB search
MSIKKDGIMVILSSPSGAGKTTLVKLLSKNKNFHISISHTTRKPRLNEIADKDYYFVDHD
KFENLIKNEEFLEYAKVFNHLYGTTRTPVIEKLEKGENVIFDIDWQGADQIKNKKLNYKL
ITFFILPPSKEILFERLSNRDMKDKLIVEERMKEFSRDVLHWINYDYVIINDDLEECYSK
ISSLIDAEINNGSKDYDKDFIRKHVEKLTS
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgtccataaaaaaagatgggataatggtaattttatcatccccatctggggcaggtaaa
acaactttagtaaaactgctctctaagaataaaaattttcatatttctatttctcatacc
acaagaaaacctagactaaacgaaattgcagacaaagattattactttgttgatcatgat
aaatttgaaaatttaataaaaaatgaagaattcttagagtacgcaaaagtatttaatcat
ctttatggaacaactagaacaccagtaattgaaaaattagaaaaaggtgaaaatgtaata
tttgatattgattggcaaggagctgatcaaatcaagaataaaaaattaaattataaatta
attactttttttattttacctcctagtaaagagatactatttgaaagactatcaaataga
gacatgaaagataaactgatagtagaagaacgtatgaaagagtttagtagagatgttttg
cattggattaattatgattatgtaattattaatgatgatctagaagagtgttattctaaa
attagcagtttaattgatgctgaaattaacaatggttcgaaagactatgataaagatttc
attagaaaacatgttgaaaaactaacctcttaa

DBGET integrated database retrieval system