KEGG   Candidatus Pelagibacter ubique: SAR11_0826Help
Entry
SAR11_0826        CDS       T00257                                 

Gene name
cysQ
Definition
cysQ protein
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
pub  Candidatus Pelagibacter ubique
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pub00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    SAR11_0826 (cysQ)
Enzymes [BR:pub01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     SAR11_0826 (cysQ)
Transfer RNA biogenesis [BR:pub03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    SAR11_0826 (cysQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(797070..797840)
Genome map
AA seq 256 aa AA seqDB search
MNLEEKKKITLSLIETFNKASQVALDLRGAGLKKEIKSDNTPVSNGDIEVNKILTSKIQE
ITPNIPIVSEESTNHKMDNDLNTFWLIDPIDGTKDYINNRDEFTLNAALILDKKPAIGII
TVPAKKRVFYSYGLSHSYELINNQEISLMNKEKNYVGHTAVSYSNDLKPEILEIHKKYKI
SSFQKMKSSLKFCVIAAGEFDMYVAEPRACEWDIAAGHAILEHSGGKVTDFNYNEILYGK
TEFKNPSLILKSKNIL
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgaaccttgaagaaaaaaagaaaattactctttcactgatagaaacttttaataaagca
agtcaggtagctttagatttaagaggagctggtttaaaaaaagaaattaaatcagacaat
actcctgtaagtaatggagatatcgaagttaataaaattttaaccagcaagatccaagaa
ataactccaaatatccctattgtttcagaagagagtacaaaccataagatggataatgat
ttaaatactttttggttaatcgatccaatagatggcaccaaagattatataaataaccgt
gatgaatttactttaaatgcagcattaatattggataaaaaacccgctattgggatcata
acagttccagcaaaaaaaagagttttttattcttacggtttgtctcacagttacgagtta
attaacaatcaagaaatttcattaatgaataaagagaaaaactatgttggacatacagca
gtaagttattctaacgatcttaaacctgaaattttagaaattcataaaaaatataaaata
agttcttttcaaaaaatgaaaagctcactaaaattttgtgttattgcagcaggtgaattt
gatatgtatgttgctgaaccaagggcttgtgagtgggatattgcagctggtcatgcaatc
cttgagcactcaggagggaaagtgactgactttaattataatgaaatactctatggaaaa
actgaatttaaaaatccaagtttaattttaaaaagtaaaaacatattataa

DBGET integrated database retrieval system