KEGG   Candidatus Pelagibacter ubique: SAR11_0851Help
Entry
SAR11_0851        CDS       T00257                                 

Definition
arylesterase (EC:3.1.1.2)
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
pub  Candidatus Pelagibacter ubique
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:pub00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    SAR11_0851
Enzymes [BR:pub01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     SAR11_0851
   3.1.2  Thioester hydrolases
    3.1.2.-  
     SAR11_0851
Lipid biosynthesis proteins [BR:pub01004]
 Fatty acid synthase
  Component type
   SAR11_0851
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
820872..821486
Genome map
AA seq 204 aa AA seqDB search
MIKRFIIKIIAVCLVSINVNALENVILFGDSLMAGYGLPQEKHLAIVLQNNLNDSGYDLG
IIDGSVSGSTSAGGLNRVEWSLSQPNIDLMILGLGANDMLRGISPIETEKNLEKIIQTAK
LKNIEIILAGMIAPTTHGISYKKKFDNIYPSLAQKYELNLIPFLLEGVALKPELNQEDGM
HPNEKGTIIISDTLTKSIINFIKK
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaagatttattattaaaattattgccgtctgtctagtgagcataaacgtcaat
gctctagaaaacgttatcttatttggtgatagcttaatggcaggctatggtcttccacag
gaaaaacatttagccattgtccttcaaaataaccttaatgatagtggttatgatcttgga
attattgatggaagtgtatctggaagcacatctgctggaggattaaatcgagttgaatgg
tctttatctcaaccgaatattgacttaatgatcttaggattgggtgctaatgacatgtta
agaggaataagcccaatcgagactgaaaaaaatttagaaaaaattattcaaacagcaaaa
ttaaaaaatatagaaataattttagcaggaatgattgcaccaacaactcatggaattagt
tataaaaaaaaatttgataatatttatccaagtttagctcaaaaatatgagttaaattta
attccttttttattagagggagttgctttaaaacctgaacttaatcaagaagacggtatg
cacccaaatgaaaaaggaactataattataagtgatacacttacaaaaagtatcatcaat
tttataaaaaaatag

DBGET integrated database retrieval system