KEGG   Candidatus Pelagibacter ubique: SAR11_0912Help
Entry
SAR11_0912        CDS       T00257                                 

Gene name
yaeM
Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase (EC:1.1.1.267)
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
pub  Candidatus Pelagibacter ubique
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pub00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SAR11_0912 (yaeM)
Enzymes [BR:pub01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     SAR11_0912 (yaeM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
876848..878014
Genome map
AA seq 388 aa AA seqDB search
MKKIAIFGSTGSIGSSLLKIIKDDQKNFKIELLTVNKNYKKLIKQVKLFNVKNVIVTDYN
SFLITTKLLKNAKVKVFNNFDSLNKIFNTNNKIDYSMCAISGFDGLKPTLDIIKFTKTIA
IANKESIICGWNLIKKDLKKYKTYFVPVDSEHFSIWSLLDNNKKNNFEKIYITASGGPFR
NLSLKKFRNISVKDALKHPNWSMGKKITIDSATMMNKVFEIIEAKKIFNLNYKQLEILIH
PKSYLHAIVKFNNGLSKLLVHDTNMTIPIFNSIYFNTDKKLKSKNIDIKTLNNLNLKKID
NIRFPVIKILNNLSNEDSLFETIIVSANDKLVKLFLNNKIKFNDISNTLIKICNTPEFNK
FKSMKPRNIDEIQNLNDYVSLKISSMSV
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaattgcaatttttggatctacaggctctattggatcatcattattaaagatt
attaaagatgatcaaaaaaactttaaaattgaattactcacagtaaataaaaattataag
aaattaataaaacaagttaaattgtttaatgttaaaaatgtaattgtcaccgattataat
tcttttttaattacaaccaaacttttgaaaaatgctaaagttaaagtttttaataacttt
gattcattaaacaaaatttttaatacaaataataaaattgattattcaatgtgtgcaatt
tcaggatttgacggattaaaaccaactttggatattattaaatttaccaaaactatagcg
atagcaaacaaagaatccattatatgtggatggaatttaattaaaaaagatttaaaaaaa
tataaaacatattttgtaccagtagattctgaacatttttctatttggtcactattagat
aacaataaaaaaaacaattttgaaaaaatttacataacagcttctggaggtccttttaga
aacttatcattaaaaaaatttagaaatatttcagttaaagatgcattaaaacatcctaat
tggtcgatgggaaaaaaaattacaatcgattctgctacaatgatgaataaagtttttgaa
attatagaagcaaaaaaaatctttaatttaaattataaacaacttgaaatattaattcat
ccaaagtcatacctacatgcaatagtaaaatttaataatggtttatcgaaacttttagtt
catgataccaatatgacaattccaatatttaattctatttattttaataccgacaaaaaa
cttaaatcaaaaaatatcgatattaaaacgttaaataatctaaatcttaaaaaaattgat
aatattagattcccagtaattaaaattcttaataatttgagtaatgaagattctttattt
gagactataattgtgagtgcaaatgataaattagtgaaactttttttaaataataagatt
aaatttaatgatatatctaatacattgataaaaatttgtaatactcctgaattcaataaa
tttaagtcaatgaagcccagaaatattgatgaaattcaaaatttaaatgattatgtaagt
ttaaaaattagctctatgagtgtataa

DBGET integrated database retrieval system