KEGG   Candidatus Pelagibacter ubique: SAR11_0927Help
Entry
SAR11_0927        CDS       T00257                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
pub  Candidatus Pelagibacter ubique
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pub00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SAR11_0927 (tpiA)
   01230 Biosynthesis of amino acids
    SAR11_0927 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAR11_0927 (tpiA)
   00051 Fructose and mannose metabolism
    SAR11_0927 (tpiA)
   00562 Inositol phosphate metabolism
    SAR11_0927 (tpiA)
Enzymes [BR:pub01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     SAR11_0927 (tpiA)
Exosome [BR:pub04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   SAR11_0927 (tpiA)
  Exosomal proteins of bladder cancer cells
   SAR11_0927 (tpiA)
  Exosomal proteins of melanoma cells
   SAR11_0927 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
892423..893148
Genome map
AA seq 241 aa AA seqDB search
MYFVANWKMYGNLSSLNTLDKVIRFSKSKEIKGGRLIYCPPNTLISSFAKKFNNCQIGIG
GQNCHESKDYGAHTGHVNSRMLKNIGAHFVIIGHSENRKQGESDKLINLKIKSALEAKLK
VIFCIGETLSEKRKKKTRSILSKQIKIGLKNIKNKSNIFIAYEPVWAIGSGIIPKSYDLF
KTIEFIKSKFRDKLPKVLYGGSVNPENITNLKKINNIDGFLIGGASQSAKKFIDIVKKTY
S
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgtattttgtagctaattggaaaatgtatgggaatttatcttctttaaatacattggat
aaagttattagattttcaaaatctaaagaaataaagggaggtagattaatttactgccct
ccaaatactttaataagttcttttgctaaaaaatttaataattgtcaaattggtattggt
ggacaaaattgtcatgaaagcaaagattatggtgctcacactggccatgttaattcccgt
atgttaaaaaacattggtgcgcattttgtaattattggtcattctgaaaatagaaaacaa
ggtgagagtgataaactaattaatctaaaaataaaaagtgctctcgaagctaaattaaaa
gttattttttgtattggtgaaactttaagtgaaaaaagaaaaaaaaagacacgttcaatt
ttatctaaacaaattaaaattggtctaaaaaatattaaaaataaatctaatatttttatt
gcttatgagcctgtttgggctattggcagtggcattataccaaaatcatatgatcttttt
aaaactatagaatttattaaaagtaaatttagagataaattgccaaaagttttatatgga
ggttcagtcaaccctgaaaatattacaaacttaaaaaaaattaataatattgatggtttt
ttgattggtggtgcatctcaaagtgctaaaaaatttattgatatagtcaaaaaaacgtat
agttaa

DBGET integrated database retrieval system