KEGG   Candidatus Pelagibacter ubique: SAR11_0927Help
Entry
SAR11_0927        CDS       T00257                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
pub  Candidatus Pelagibacter ubique
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; Carbon metabolism [PATH:pub01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:pub01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:pub00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:pub00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:pub00562]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
892423..893148
Genome map
AA seq 241 aa AA seqDB search
MYFVANWKMYGNLSSLNTLDKVIRFSKSKEIKGGRLIYCPPNTLISSFAKKFNNCQIGIG
GQNCHESKDYGAHTGHVNSRMLKNIGAHFVIIGHSENRKQGESDKLINLKIKSALEAKLK
VIFCIGETLSEKRKKKTRSILSKQIKIGLKNIKNKSNIFIAYEPVWAIGSGIIPKSYDLF
KTIEFIKSKFRDKLPKVLYGGSVNPENITNLKKINNIDGFLIGGASQSAKKFIDIVKKTY
S
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgtattttgtagctaattggaaaatgtatgggaatttatcttctttaaatacattggat
aaagttattagattttcaaaatctaaagaaataaagggaggtagattaatttactgccct
ccaaatactttaataagttcttttgctaaaaaatttaataattgtcaaattggtattggt
ggacaaaattgtcatgaaagcaaagattatggtgctcacactggccatgttaattcccgt
atgttaaaaaacattggtgcgcattttgtaattattggtcattctgaaaatagaaaacaa
ggtgagagtgataaactaattaatctaaaaataaaaagtgctctcgaagctaaattaaaa
gttattttttgtattggtgaaactttaagtgaaaaaagaaaaaaaaagacacgttcaatt
ttatctaaacaaattaaaattggtctaaaaaatattaaaaataaatctaatatttttatt
gcttatgagcctgtttgggctattggcagtggcattataccaaaatcatatgatcttttt
aaaactatagaatttattaaaagtaaatttagagataaattgccaaaagttttatatgga
ggttcagtcaaccctgaaaatattacaaacttaaaaaaaattaataatattgatggtttt
ttgattggtggtgcatctcaaagtgctaaaaaatttattgatatagtcaaaaaaacgtat
agttaa

DBGET integrated database retrieval system