KEGG   Candidatus Pelagibacter ubique: SAR11_0972Help
Entry
SAR11_0972        CDS       T00257                                 

Definition
glycosyl hydrolase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
pub  Candidatus Pelagibacter ubique
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pub00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    SAR11_0972
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    SAR11_0972
Enzymes [BR:pub01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     SAR11_0972
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
954688..955638
Genome map
AA seq 316 aa AA seqDB search
MMDNRKSFIVGLKSTKLLTSEKKFLIKHKPWGIILFSRNIKNIEQLKKLTGQIRKIFNDK
KYPILIDQEGGRVNRLKKFFKADKFTGEFFGNLYLKDKKKFYIEYKKFINKTVLLLKNVG
ININTLPVLDVRSKGSSAIIGDRAFSDNAKIVSEIGDICIKEFHNNKIATVIKHIPGHGL
AKVDSHKKTPTINKELRYLNNHDFLAFKNKNSLFAMTAHLIYKKIDKVNTATHSKKIIKL
IRNLIKFRNILMSDDISMKSLKGSIAINTKKSFSAGCDLVLHCNGNLKEMNDVALYSPVI
SKFIKKKTSQFYKIIS
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgatggataatcgtaaaagtttcatagttggtttaaaatctactaaattattgactagt
gaaaaaaaatttctaattaaacacaagccttggggaataatacttttttcaagaaatatt
aaaaatattgaacaattaaaaaaattaacaggtcaaattagaaaaatattcaatgataaa
aaatatcctattttaattgatcaagagggtggtagagttaatagattaaaaaaatttttt
aaagcagataagtttactggagaattttttggtaatctttatcttaaagataaaaaaaaa
ttttatatcgaatataaaaagtttatcaataaaactgtcttattattaaaaaatgtagga
attaacataaatactttaccagtccttgatgttagatccaaaggatcaagtgcaataatt
ggtgacagagccttttcagacaatgcaaagattgtttcagaaattggagatatttgtatt
aaagagtttcataataataaaattgccactgtgataaagcatataccaggacatggttta
gcaaaggtcgatagtcataaaaaaactcctacaatcaataaggaattaagatatttaaat
aatcatgactttttggcattcaaaaataaaaacagtttatttgcaatgacagcacatctt
atttataaaaaaattgacaaagttaataccgcaacacattcgaagaaaattataaaatta
ataagaaatctaattaaatttagaaatattttgatgtccgacgatatatcaatgaaaagt
ttaaaaggctctatagcaattaatacaaagaaatcttttagtgcaggttgtgatttagtt
cttcattgtaatggaaatttaaaagaaatgaatgatgtagccctatattcaccagttata
agtaagtttattaaaaaaaaaacatcacaattttataagattataagctaa

DBGET integrated database retrieval system